KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1346Help
Entry
GY4MC1_1346       CDS       T01348                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1317986..1318552
Genome map
AA seq 188 aa AA seqDB search
MSHVNYEQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAELFSGLHEDPKQYFQTVFN
EDHEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRDGKVTGLSKLARAVEAVARRPQLQ
ERITATVADSIMETLDPYGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDQTARA
EVLSLIKG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgtgaattatgaacaaattgaatatgccgttcgtttaattttagaggcaatt
ggcgaagatccgaatcgtgaaggattagtcgacacgccaaagcgggtcgcaaagatgtac
gcggaattattttccggattgcatgaagatccgaagcaatattttcaaaccgtgttcaat
gaagaccatgaggagttagtgcttgtcaaagatattccgttttactccatgtgcgagcac
catttggtcccgtttttcggcgtcgcgcatgttgcctatattccccgtgacggaaaagtg
acaggattaagcaagctggcgcgagcggtggaggcggtagcacgccgtccgcaattgcag
gagcgcataacggcgaccgttgccgattcgattatggaaacattagatccatacggagta
atggtagtggtggaagcggaacatatgtgcatgacgatgcgcggcgtgaaaaagccggga
gccaaaacggtgacaacggcggtgagaggagtgtttgaaaccgaccaaacagcccgtgcg
gaagtgctttccctcataaaaggataa

DBGET integrated database retrieval system