KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1346Help
Entry
GY4MC1_1346       CDS       T01348                                 

Definition
(RefSeq) GTP cyclohydrolase I (EC:3.5.4.16)
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GY4MC1_1346
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GY4MC1_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1317986..1318552
Genome map
AA seq 188 aa AA seqDB search
MSHVNYEQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAELFSGLHEDPKQYFQTVFN
EDHEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRDGKVTGLSKLARAVEAVARRPQLQ
ERITATVADSIMETLDPYGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDQTARA
EVLSLIKG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgtgaattatgaacaaattgaatatgccgttcgtttaattttagaggcaatt
ggcgaagatccgaatcgtgaaggattagtcgacacgccaaagcgggtcgcaaagatgtac
gcggaattattttccggattgcatgaagatccgaagcaatattttcaaaccgtgttcaat
gaagaccatgaggagttagtgcttgtcaaagatattccgttttactccatgtgcgagcac
catttggtcccgtttttcggcgtcgcgcatgttgcctatattccccgtgacggaaaagtg
acaggattaagcaagctggcgcgagcggtggaggcggtagcacgccgtccgcaattgcag
gagcgcataacggcgaccgttgccgattcgattatggaaacattagatccatacggagta
atggtagtggtggaagcggaacatatgtgcatgacgatgcgcggcgtgaaaaagccggga
gccaaaacggtgacaacggcggtgagaggagtgtttgaaaccgaccaaacagcccgtgcg
gaagtgctttccctcataaaaggataa

DBGET integrated database retrieval system