KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1358Help
Entry
GY4MC1_1358       CDS       T01348                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01130  Biosynthesis of antibiotics
gmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GY4MC1_1358
Enzymes [BR:gmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GY4MC1_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADP74159
UniProt: A0A0F6BL58
Position
1328371..1329150
Genome map
AA seq 259 aa AA seqDB search
MLEQIIATKRKEVEALILPEPLRNVQRRSLSAALKKPNRFIGLIAEVKKASPSKGLIRPD
FHPAAIAKAYEKAGADAISVLTDERYFQGHRSYLSDVKQAVQLPVLRKDFIIHRMQIEES
VRIGADAILLIGEALPAKTLYELYQEARDKGLECLVEVHQRETLESILDIFTPEIIGINN
RNLHTFVTTLETTSKVIPFVPDGSVIVSESGIAASADLQAVKTYGANAVLVGEALMRKDN
VEAAIYELFQEVGTIGRPS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacaaattatcgcaacgaaacgcaaagaagtagaagcgctcatattgccggag
ccgctgcgaaacgtgcagcgccgttcgctatcagcagcgttgaagaagccaaaccgcttt
atcggccttatcgctgaagtgaagaaggcttccccatccaaagggttgattcgtcccgat
tttcatcctgcggcgatcgcgaaagcgtacgaaaaagcgggagcggatgcgatcagcgta
ttgacggatgaacggtatttccaagggcatcgcagttatttgagcgatgtgaaacaagcg
gtgcagcttccggttttgcgcaaagattttattatccatcggatgcaaattgaagagagt
gtgcgaatcggagcggatgcgattttattaatcggcgaggcgctgccggcaaaaacgttg
tatgagctatatcaggaggcgcgcgacaaagggttggaatgtttagtggaagtgcaccag
cgcgaaacattggaaagcattttagatatttttacgccggaaattatcggtattaacaac
cgcaatttgcatacgtttgtcaccacgctggaaacgacaagcaaagtcatcccgttcgtg
ccagatggcagcgtgatcgtcagcgaaagcggcatcgctgcttctgccgatttgcaagcg
gtgaaaacgtatggcgcaaacgcggtgcttgtcggggaagcgctgatgcgaaaggataat
gtcgaagccgcgatttacgagctattccaggaggtgggtacgattggccgtccgtcttaa

DBGET integrated database retrieval system