KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1360Help
Entry
GY4MC1_1360       CDS       T01348                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GY4MC1_1360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GY4MC1_1360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GY4MC1_1360
Enzymes [BR:gmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GY4MC1_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1329768..1330982
Genome map
AA seq 404 aa AA seqDB search
MYNVPNENGRFGDFGGKFVPETLMIPLEEIEEELDKALADDAFKAEYMRILQEYSGRPTP
LTFAPNLTKKLNGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKIIAETGAGQHGV
AAATVAAHFGMECIVFMGEEDIKRQELNVFRMKLLGAEVVPVYSGNRTLKDATNEAIRYW
VQHCDDHFYMIGSVVGPHPYPKMVREFQRIIGDEAKQQFLEREGKLPDMIVACVGGGSNA
MGMFYPFLEDDVTLVGVEAAGKGIDTPYHAATITKGTKGVIHGSMTYLLQDEYGQIIEPY
SVSAGLDYPGVGPEHAYLASIGRVRYESVTDAEAIEAFQLLSREEGIIPAIESAHALAKA
VQLAKTMRNDQTVLVCLSGRGDKDVQTMMNYLKGGNDVAIANRH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtataacgttccaaacgaaaacggcagatttggcgattttggcggaaaattcgttccc
gaaacgttaatgattccgctcgaagaaatagaggaagagctcgacaaggcgctcgccgat
gatgcgtttaaagcggaatatatgcgaattttgcaagagtattccggccggccgacgccg
cttacgtttgcgcctaatttaacgaaaaaactaaatggcgcaaaaatttacttgaaacgg
gaagatttaaaccacaccggcgcccataaaatcaataatgcgatcggacaggcactgctc
gctaaacggatgggaaagaaaaaaatcattgccgaaacgggagcagggcagcacggtgtt
gccgcggcgacggtagcagcccacttcggaatggaatgcatcgtatttatgggggaagaa
gatatcaaacggcaggaattgaacgtattccggatgaaattattgggagccgaagttgtt
cccgtttacagcggcaaccgcacattgaaagacgcgacaaatgaagcgattcgctattgg
gtgcaacattgtgatgaccatttctatatgatcggttctgttgtcggcccgcatccgtat
ccaaaaatggtgcgtgaatttcagcggattatcggtgatgaggcgaaacagcaattcctt
gagcgggaaggaaagctgccggatatgatcgtcgcgtgtgtgggcggcggaagcaatgcg
atgggcatgttttatccgtttttggaagatgatgtgacgcttgtcggcgtggaagcggcc
ggaaaaggaatcgacacgccgtatcatgccgcaacgatcacaaaaggaacaaaaggggtc
attcatgggtcgatgacgtatttgttgcaagatgagtacgggcaaattattgaaccgtat
tccgtttcggcaggccttgattatcctggggttggaccggagcacgcttatttggccagc
atcggccgcgttcgttacgaaagcgttacggatgccgaagcgatcgaggcgttccaactg
ctgtcaagggaagaagggatcattccggcgatcgagtcagcgcatgctttggcgaaggcg
gttcagcttgcgaaaacgatgcgaaacgatcaaacggtgctcgtttgcttatcaggccgc
ggcgataaagatgtgcagacaatgatgaattacttaaaagggggaaatgatgttgccatt
gctaaccgtcactaa

DBGET integrated database retrieval system