KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1361Help
Entry
GY4MC1_1361       CDS       T01348                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GY4MC1_1361
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GY4MC1_1361
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GY4MC1_1361
Enzymes [BR:gmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GY4MC1_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1330957..1331763
Genome map
AA seq 268 aa AA seqDB search
MLPLLTVTKPMFIPFIVAGDPRPDITVELALALQEVGADILELGVPYSDPLADGPIIQRA
AARALRQQMTLQKAIELIPAMRKKGVKIPIIIFTYYNPVLQLGKESFFALAQKNGANGVL
IPDLPFEESAPVRKLGEAAGIPLISLVAPTSKKRIAMIASNAQGFVYCVSSLGVTGVRDT
LPETLHEFLAEVKRHSRVPVVVGFGISKSEQVSMLKHYCDGVVIGSALVQKIEQLSDRLQ
TPEKKEEALAEFRRYARSLAAPLNETVQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttgccattgctaaccgtcactaagccgatgtttatcccgtttattgttgccggagat
ccccgcccggatataacagttgagcttgccttggcgcttcaagaggtgggagccgatatt
ttggaattgggcgtgccgtattccgatccgttagcggatggcccgattattcaacgggcc
gcggcaagagcgttgcgccagcagatgacgctgcaaaaagcgatcgaattaatccctgca
atgcgaaaaaagggcgtaaaaattccgattattatctttacgtattacaatcctgtgtta
caattagggaaagaatccttttttgctttagcgcaaaaaaatggagcgaacggcgtttta
attccggatttgccttttgaagaaagcgccccggttcgcaagcttggcgaagcggcggga
atcccgctgatttcgctcgtggcgccgacatcgaaaaagcgcatcgcaatgatcgcttcc
aatgcgcaaggatttgtatattgcgtttcctctctcggtgtgaccggcgtgcgtgataca
ctgccggaaacattgcacgaatttttggcagaagtaaaacggcatagccgtgttcctgtc
gtcgttggatttggcatttcgaaaagcgaacaagtaagcatgctaaaacattattgtgac
ggggtcgtcatcggcagcgcgctcgtccaaaaaattgaacagcttagcgaccgcttgcaa
acaccggagaaaaaagaggaagcgctcgccgagtttcgccgttacgctcgctcgctggca
gcaccgctcaatgaaacggtgcaataa

DBGET integrated database retrieval system