KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1408Help
Entry
GY4MC1_1408       CDS       T01348                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GY4MC1_1408
  Lipid metabolism
   00561 Glycerolipid metabolism
    GY4MC1_1408
   00600 Sphingolipid metabolism
    GY4MC1_1408
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GY4MC1_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1371597..1373786
Genome map
AA seq 729 aa AA seqDB search
MGIIYDPIMRIFHLQANDMSYIMQLVGRGYLAHFYWGKRIRKANGSRKLRFLSRPFSPNP
DPSARAFSLDTLPQEYPAYGNTDFRAPAYQVQLENGSTISDLHYKTHRIYKGKPELEGLP
ATYAENENEAETLEIILQDRVIGLHVTLLYTVYERWNVMTRSVRLENNGAERIKLLRALS
MNVDFPHADYEWLHLPGAWARERAVERRPLVTGVQSVESRRGASSHQQNPFIALLRKNVD
EDHGEVYAFNLVYSGNFLAQIEVDQFQTARVSMGINPFDFTWLLEPGESFQTPEVVMVYS
DKGLNGMSQTYHQLYRTRLARGAFRDRERPILINNWEATYFHFDEEKILRLAKTAAELGI
ELFVLDDGWFGKRDNDRSSLGDWFVHKQKLPNGLEGLAKRINQMGMQFGLWVEPEMVSVD
SELYRKHPDWCLHVPNRPRSEGRNQLVLDYSRKEVCDYIIQVISDVLASAPISYVKWDMN
RHMTEIGSAALPPERQRETAHRYMLGLYRVMEEITSRFPHVLFESCSGGGGRFDPGMLYY
MPQTWTSDNTDAVSRLKIQYGTSLVYPIISMGAHVSAVPNHQVHRITSLEMRGHVAMSGN
VGYELDLTKLSETEKQTVKEQVAFYKEIRRLVQFGTFYRILSPFEGNEAAWMFVSADRSE
ALVAYFRVLAEANAPLSFIRLKGLDPKKDYKLVGSGEIYGGDELMHIGLIVPQRRGDFVS
IIWRLKAAR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggggattatctatgatccaatcatgagaatatttcatctgcaggcaaatgatatgagt
tatataatgcaacttgtcggacgtggatatttagcccacttttactggggaaaaagaatc
cggaaagcgaatggctcgcgaaaactgcggtttctcagccgcccgttttctcctaatccc
gatccatccgcccgcgcgttttctttagatacgctgccgcaagaatacccggcatatggc
aacacggattttcgcgcgccggcgtatcaagtgcaattagaaaacgggtcgacgatctcg
gatttgcactataaaacgcatcgcatttataaaggaaagccggagctggaagggctgccg
gccacttatgcggaaaacgaaaacgaagcggaaacgttagaaatcatattgcaagaccgc
gtaatcggattacatgtcacactgctttatacggtatatgagcgatggaatgtgatgaca
cgttctgtccgcttggaaaacaacggtgcggaacggatcaagctgttgcgggcgttaagc
atgaatgtcgatttcccgcatgctgactatgaatggctgcatttgccgggagcgtgggca
cgggagcgggcggtggaaaggcggccgcttgtcacgggcgtacaatcggtagaaagccgc
cgcggcgccagcagccaccagcaaaacccgtttatcgccttgttgagaaaaaatgtggat
gaagatcacggcgaagtatatgcctttaatcttgtatacagcggcaattttctcgctcaa
atcgaagtcgaccaattccagacggcgcgtgtatccatgggaatcaatccgtttgatttt
acgtggctgttagaaccgggcgagtcgttccaaacgccggaagtggtgatggtatattca
gataaaggattaaatggaatgtcgcaaacttatcaccagttataccgcacccgcttggcg
cgcggggcgttccgcgatcgggagcgcccgattctcatcaataactgggaagcgacctat
tttcattttgatgaagagaaaattttgcgccttgcgaaaacagcagcggaattagggatt
gaactgtttgtgcttgatgacggctggtttggcaaacgcgataatgatcgcagttcatta
ggagattggtttgtccataaacagaagctgccaaatgggctagaagggctggcaaaacgc
attaaccaaatgggcatgcagtttggcctatgggtggaaccggaaatggtttccgttgac
agcgagctgtaccggaagcatccggactggtgccttcatgtgccgaaccgtccgcgttcg
gaagggagaaaccagcttgtattagactattcccgcaaagaagtgtgcgattatatcatt
caagtcatttccgatgtgctagcgagcgcaccgatttcgtatgtcaaatgggatatgaac
cgtcatatgacggaaatcggctctgccgccctgcctccagaacggcagcgcgaaacggct
caccgctacatgctggggttgtaccgcgtcatggaagaaataacgtcccgttttccgcac
gttctgtttgagagctgctcgggcggcggaggccggtttgacccgggcatgctgtactat
atgccgcaaacgtggacgagtgataatacggacgcggtttcccgcttaaaaatccaatac
ggcaccagccttgtttacccaatcatctcgatgggcgcgcatgtgtcagcggtgccgaac
caccaagttcatcgcattacatcgttggaaatgcgcggtcatgtggcgatgtcgggaaac
gttggctatgaactggatttaacgaaactaagtgagacagaaaaacaaacggtaaaagag
caagtggcattttacaaagaaatccgccgtcttgtccaatttgggacgttttaccggata
ctcagcccgtttgaaggcaatgaggcggcatggatgttcgtatccgcggaccgatcagaa
gcattggtcgcctacttccgcgtgctggcggaagcgaatgcgccgctgtcgttcatacgg
ttaaaagggctggatcctaagaaagattacaaactcgtcggcagcggggaaatatatggc
ggcgatgaactgatgcatatagggttaattgtgccgcagcggcgcggcgacttcgttagc
atcatttggcggttaaaagcagctcgttaa

DBGET integrated database retrieval system