KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1446Help
Entry
GY4MC1_1446       CDS       T01348                                 

Definition
(RefSeq) glycoside hydrolase family protein
  KO
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_1446
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     GY4MC1_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1419155..1420591
Genome map
AA seq 478 aa AA seqDB search
MRKSVLPENFLWGGAVAAHQLEGGWNKGGKGISVADVMTAGRHGVPRQITDGVLEGYYYP
NHEAIDFYSRYKEDIKLFAEMGFKCFRTSIAWTRIFPNGDDPEPNEEGLQFYDDLFDELL
KYNIEPVITLSHFELPYNLVKKYGGFRNRKCIDFFVKFSETVMKRYKDKVKYWMTFNEIN
NQADTSMDFASFTNSGIIYEKGENREQTMYQAALYELIASAKVVKLGHEINPNFKIGCML
SFVPVYPYSCHPDDVMFATEAMRNRWFFGDVHVRGEIPNYTKKYWERNGFEIEYTKEDEQ
ILKEGTVDYIGFSYYMSKVVSAREVEGSEPDGEFGHIVRNPYVKASEWGWQIDPVGLRYS
LNALYERYNIPLFIVENGLGARDVVEADGTINDDYRIQYLRDHIKEMKKAVELDGVDLIG
YTPWGCIDLVSAGTGEMEKRYGFIYVDKDNEGNGTLERRKKKSFYWYKRVIETNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagtgttttaccggaaaactttttatggggtggagcagtagcagctcaccag
cttgaaggtggctggaataaaggtggaaaagggataagtgttgcagatgtgatgactgca
ggaagacatggtgttcctcgtcaaattacagatggtgtgttagaagggtactattatccg
aaccatgaagcgattgacttctattctcgttataaagaagatatcaaactctttgctgaa
atgggatttaaatgtttccgtacttctatcgcttggacaagaatttttccgaatggagac
gatcctgaaccaaatgaagaaggattacaattttacgatgatttatttgatgaattatta
aaatataatatcgaacccgttattaccctttctcattttgaattaccttataatcttgtg
aaaaaatatggtggctttagaaaccggaagtgtattgatttctttgtgaaattttctgag
acagttatgaaacgttataaagataaagtgaaatactggatgacatttaatgaaatcaat
aaccaagcagatacaagtatggatttcgctagctttacaaattcaggaattatatatgag
aaaggcgaaaatcgggaacaaacaatgtatcaagcagctctttatgaattaattgctagt
gcaaaagttgtaaaattaggccacgaaattaaccctaattttaaaatcggttgtatgctt
tcttttgtaccggtatatccatactcttgtcatccagatgatgtgatgtttgccactgaa
gcaatgcgtaatcgctggttctttggtgatgtacatgttcgaggtgaaattcctaattat
acgaagaaatattgggaaagaaatggttttgaaattgaatatacaaaggaagatgaacaa
attcttaaagaaggtacagtagattatattggatttagctattatatgtctaaggtagtc
agtgctcgtgaagtagaaggcagtgaacctgatggagaatttggtcatatcgttcgtaat
ccttatgtcaaggcaagtgaatggggttggcaaattgacccagtaggcctccgttattca
ttaaacgctttatacgaacgatataatattcctttatttattgtggaaaatggtctcggt
gctagggatgtcgttgaagcagacggtacgataaatgatgattaccgtattcaatatctg
cgtgatcatattaaagaaatgaaaaaagcagtggaattagatggtgttgatttaatagga
tatacaccatggggctgtattgatttagttagtgctggaactggagaaatggaaaaacgt
tatggctttatttatgtagataaagataatgaaggaaatggtacgttagaaaggagaaag
aaaaaatctttttattggtataagcgtgttattgaaacaaatggagaagaactttaa

DBGET integrated database retrieval system