KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1457Help
Entry
GY4MC1_1457       CDS       T01348                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K20534  
polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
Enzymes [BR:gmc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     GY4MC1_1457
Glycosyltransferases [BR:gmc01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   GY4MC1_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1430659..1431621
Genome map
AA seq 320 aa AA seqDB search
MVKYSVVIPVYNEALVIRETYRRLKRVMEQTDGPYELLFVNDGSEDETIDILKELAVKDE
TVKYVDFSRNFGHQIAITAGMDYAAGKAIVIIDADLQDPPELILEMIEKWKEGYDVVYAK
RVKRKGETIFKKVTAYLFYRVLRAATEIDIPVDTGDFRLIDRKVRDQLVFMRERSRFVRG
LISWVGFKQTAVEYEREERFAGKTKYPLKKMIRFSLDGITSFSYKPLKLASLLGFFLSAS
SVLGMIITLYLKLFTYSTVAGWASLLMVMLLCNGVMFIMIGVIGEYIGRIYDEVKQRPLY
IVKETWGVGTKYGKVPFYVE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaatattctgtggtgattccggtatataatgaggcgcttgtcatccgcgaaaca
taccgccggttaaagcgcgtgatggagcaaaccgatgggccgtatgaactgttgtttgtc
aatgatggcagcgaagatgaaaccatcgatatattaaaagaacttgccgtgaaagatgaa
acggtcaaatatgtggatttttcccgcaattttggccaccaaatcgcgattaccgctgga
atggattatgcggccggaaaagcgattgtgattattgacgccgatttgcaagatcctccg
gagttaattttagaaatgatcgaaaaatggaaagaaggctatgacgtcgtgtacgccaaa
cgagtgaaacgaaaaggggaaacgatatttaaaaaggttaccgcttatctgttttaccgg
gtgctgcgggcggcgactgaaatcgacattcctgtcgataccggcgattttcgccttatt
gaccggaaagtgcgcgatcagttagtctttatgagagaacggagccgctttgtccgcggg
ctcataagctgggtcggattcaagcagacggctgtggaatatgaacgggaggagcggttt
gccgggaaaacaaagtatccgctcaaaaaaatgatccgtttttcgcttgacggaatcact
tcgttttcgtacaaaccattgaagctcgctagtttgttaggctttttcctgtccgcctcc
agcgtgcttggcatgatcatcactttatatttaaagctgtttacgtattcgacggtggcg
ggatgggcgtcgcttttaatggtgatgctgttatgcaacggcgttatgtttataatgatt
ggcgtgatcggggaatatattggccgcatttatgatgaggtaaagcagcgtccgctatat
atcgtcaaagagacatggggagtcggaaccaaatatggaaaagtaccgttttatgtggaa
tga

DBGET integrated database retrieval system