KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1489Help
Entry
GY4MC1_1489       CDS       T01348                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00071  Fatty acid degradation
gmc00280  Valine, leucine and isoleucine degradation
gmc00281  Geraniol degradation
gmc00310  Lysine degradation
gmc00360  Phenylalanine metabolism
gmc00362  Benzoate degradation
gmc00380  Tryptophan metabolism
gmc00410  beta-Alanine metabolism
gmc00627  Aminobenzoate degradation
gmc00640  Propanoate metabolism
gmc00650  Butanoate metabolism
gmc00903  Limonene and pinene degradation
gmc00930  Caprolactam degradation
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01212  Fatty acid metabolism
Module
gmc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GY4MC1_1489
   00650 Butanoate metabolism
    GY4MC1_1489
  Lipid metabolism
   00071 Fatty acid degradation
    GY4MC1_1489
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GY4MC1_1489
   00310 Lysine degradation
    GY4MC1_1489
   00360 Phenylalanine metabolism
    GY4MC1_1489
   00380 Tryptophan metabolism
    GY4MC1_1489
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GY4MC1_1489
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GY4MC1_1489
   00281 Geraniol degradation
    GY4MC1_1489
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GY4MC1_1489
   00627 Aminobenzoate degradation
    GY4MC1_1489
   00930 Caprolactam degradation
    GY4MC1_1489
Enzymes [BR:gmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GY4MC1_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADP74280
UniProt: A0A0F6BLH9
Position
1464817..1465593
Genome map
AA seq 258 aa AA seqDB search
MTEFAHIRTHVDENVAVIELHRPDVLNALNRKMVTEIVSAMEFYDRDEHVRVIVLTGSGR
AFAAGADIDEMANDDSITLELLNQFAEWDRLALIKKPTIAAVHGFALGGGFELALSCDLL
FAADTAEFGFPEVNIGVMPGAGGTQRLTKLIGKTKALEWLWTGERMSAKEAHELGIVNRV
IAPELLDEETMRFAKKLAKQPPLSVRLIKEAVNKAVDYSLYEGMQFERKNFYLLFSSEDQ
KEGMAAFIEKRKPRFQGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtttgcgcacattcgcacacatgttgatgagaatgttgctgtgattgaactg
catcgcccagacgtgttaaacgccttgaataggaaaatggtaacggaaatcgtcagcgcg
atggaattttacgaccgcgatgaacatgtgcgcgtcatcgtcttgacaggaagcggccgt
gcctttgcagcaggagcggatatcgacgaaatggcaaacgatgattccattacgctggaa
ttgcttaatcaatttgccgaatgggatcgccttgcacttattaaaaagcctacgattgcc
gccgtacacggttttgcattaggcggaggattcgaactcgcgcttagctgtgacctgttg
tttgcggccgatacagcggaattcggatttccggaagtgaatatcggtgtgatgccaggt
gcgggcggaacgcagcgccttactaaattaatcggcaaaacaaaagcgctcgagtggctt
tggacaggcgagcgtatgtcggcaaaagaagcgcatgaattagggattgtcaaccgtgtc
atcgcgccagagttattggatgaggaaacaatgcggtttgcgaaaaagctggcaaaacag
cctcctttatccgtccgcctaattaaagaagccgtgaataaggcagtagactattcgcta
tatgaaggcatgcagtttgagagaaaaaatttttatctccttttttcgtctgaggatcaa
aaagagggaatggcggcatttatcgaaaaacgaaagccgcgttttcaaggaagataa

DBGET integrated database retrieval system