KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1505Help
Entry
GY4MC1_1505       CDS       T01348                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00020  Citrate cycle (TCA cycle)
gmc00620  Pyruvate metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
Module
gmc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_1505
   00020 Citrate cycle (TCA cycle)
    GY4MC1_1505
   00620 Pyruvate metabolism
    GY4MC1_1505
Enzymes [BR:gmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GY4MC1_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ADP74296
UniProt: A0A0F6BLJ5
Position
1480305..1481558
Genome map
AA seq 417 aa AA seqDB search
MEVKLHDIGEGMTEAVVLSYFVKKGDYVKADQPLVEVQTDKMVAEIPAPAAGIIQDILVP
EGKTISVGTTILTLKATSPPLAEMRSNPPEVPTESTPPFVMKEEKAAFAKRAVERRVLAS
PHTRKIAREHGVDLEQVVGTGRGGRITDEDVYRFIETNNAKQANHLSVAGGDTEVPSFAK
ADDHAPAFSVIPFRGRRKQIAKKMAQSLYTIPHCTHFEEVDVTELIWFREELKQHNFHIS
ATAFFIKALSLALKKFPIFNARLDEECEEIHLKQEHHIGIAVDTEEGLIVPVIKHVESKS
LREIHEEAKRLTKKAQENKLELQEMTGSTFTISNVGPLGGSIGATPIINYPEVALMAFHK
TKKRPVVMENDEIAVRSMMNISMSFDHRIADGATAVAFTNYFVRLIENPKLMLMELV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaagcttcatgatatcggcgaaggaatgaccgaagcagtcgtattaagttat
ttcgttaaaaaaggggactatgtaaaggcagaccagccgctagtcgaagtgcagacagat
aaaatggtggcggaaatacctgcgccagccgcaggcatcatccaagatattctcgttccc
gaaggaaaaacaatttcagttggcacgacgattcttacgttaaaagcaacatcaccgcca
cttgcggaaatgcggtccaatccgccggaagtgccgacagaatccactccaccgtttgtc
atgaaagaagaaaaggcagctttcgctaagcgggcggtagaacggcgcgtgcttgcctca
ccgcatactcggaaaattgcccgcgaacacggggtggatttagaacaagttgttggcaca
ggacgaggcggccgaattaccgacgaagacgtgtaccgctttatcgaaactaacaatgcg
aagcaagcgaatcatttatcagttgcaggcggcgatacggaagttccatcattcgcaaaa
gcggatgaccatgcaccagcgttttctgtcatcccgttccgcggccgccgcaagcaaatc
gcgaaaaaaatggcgcaatcgttatatacgattccgcattgcacacattttgaagaagtc
gatgtcactgagctcatctggttccgtgaagaactgaaacagcacaatttccatatttcc
gcaacggcgtttttcattaaagcattgtcgcttgcgttaaagaagtttccgatatttaat
gccaggcttgatgaagagtgcgaagagatccatcttaaacaagagcatcatatcggcatt
gcagtcgacacagaagaaggattaatcgtgccagtcatcaaacatgtcgaaagcaagtca
ctgcgggagattcatgaagaagcgaaacgtctcacgaaaaaagcgcaagaaaacaaacta
gagctccaagaaatgacaggaagcacatttaccatcagcaatgttggcccgctcggcggc
agcattggtgcaacaccaattattaattatccagaagtggcacttatggcgttccacaaa
acaaaaaaacgtcctgttgtcatggaaaacgatgaaatcgcagtgcgctcaatgatgaac
atctcgatgtcatttgaccatcgcattgccgatggcgcgacagcggtggcgtttaccaac
tatttcgtaagactgattgaaaatccaaaactaatgttaatggagttggtataa

DBGET integrated database retrieval system