KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1628Help
Entry
GY4MC1_1628       CDS       T01348                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00620  Pyruvate metabolism
gmc00630  Glyoxylate and dicarboxylate metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01200  Carbon metabolism
Module
gmc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GY4MC1_1628
   00630 Glyoxylate and dicarboxylate metabolism
    GY4MC1_1628
Enzymes [BR:gmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GY4MC1_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Phage_Mu_Gam
Motif
Other DBs
NCBI-ProteinID: ADP74405
UniProt: A0A0F6BLV4
Position
1598635..1600818
Genome map
AA seq 727 aa AA seqDB search
MGEYVKVGNLQVAKLLYEFINDEVLPGSEVNSETFWKDFETLIADLTPRNKALLARRDEI
QEKINQWHKEHRDNFNKEEYKAFLTEIGYLEPEVDDFEITTEGVDDEIAIQAGPQLVVPV
TNARYALNAANARWGSLYDALYGTDAISEEGGAERGDSYNPVRGAKVIAYAREFLDQAVP
LKEYSHKDAVQYAVVDGKLVVSVDGGKTTTLKEEEKFVGFQGNPENPTAVLLKNNGLHIE
IQIDRSHPVGKTDKAGVKDVYLEAAVTTIMDCEDSVAAVDAEDKVLVYRNLLGLVKGDLT
ATFTKDGKTITRELKPDRVYQTPDGKELTLPGRSLMFVRNVGHLMTNNAILDANGEEVYE
GIIDAVVTSLIMKHSLLGNTRYANSRKGSIYIVKPKMHGSEEVAFANELFDRVEDMLGLK
RNTIKIGVMDEERRTTLNLKNCIYQVKDRIVFINTGFLDRTGDEIHTSMEAGPMIRKNDM
KTSAWLQGYEKSNVSIGLATGFQGRAQIGKGMWAMPDMMAEMLKQKGGQLKAGANTAWVP
SPTAATLHALHYHQINVAEVQEELRKEQKDYRDEILQIPVAVNPQWTPEEIQEELDNNCQ
GILGYVVRWIDQGIGCSKVPDINNIGLMEDRATLRISSQHIANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPDYDNSVAFQAACDLIFKGYEQPNGYTEPILHRRRLEAKA
KYAAIQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatacgtaaaagttggaaatctccaagtcgcaaaactgctttatgagtttata
aacgatgaagtgcttccgggaagcgaagtgaacagcgaaacattttggaaagactttgaa
acgctgattgccgatttaacgccgagaaacaaagcgctgcttgcgcgccgcgatgaaatt
caagaaaaaataaatcaatggcataaagagcaccgcgacaattttaacaaggaagaatat
aaagcgtttttaacggagatcggctatttagagccagaagtggacgatttcgagattacc
accgaaggagtggacgatgaaattgccattcaagctggcccgcaattggtcgtgccggtt
acgaatgcccgctatgcgctgaatgcagcgaatgcccgttggggcagcctttatgatgcc
ttatatggaacagatgcgatcagcgaagaaggcggggcagaacgcggtgattcttacaat
ccggtccgtggggcaaaagtaattgcttatgcgcgcgagtttctcgatcaagccgtgccg
ctgaaagaatattcgcacaaagacgccgttcaatatgcggtagttgacggaaaactggta
gtatccgttgacggcggcaagacgacaacgctaaaagaggaagaaaaattcgtcggtttc
caaggaaacccggaaaatccgacggcggttttgttaaaaaataacggtcttcacatcgaa
attcaaattgaccgcagccaccctgtcggaaaaacggataaagcaggtgtgaaagatgtt
tatttagaagcggcggttacgacgattatggactgcgaagattcggtggcggcagttgac
gcggaagataaggtgctcgtataccgcaatttgctcggccttgtcaaaggagatttaacg
gcaacgttcacaaaagacggaaaaacgataacacgcgagctaaaaccggatcgcgtttat
caaacgccggatggtaaagaacttactctgccaggccgttcgcttatgttcgtccgcaac
gttggccatttgatgacgaacaatgcgattttggatgcaaacggcgaagaagtatatgaa
ggaatcatcgatgcggtcgtgacaagcttaattatgaaacattcgcttcttggcaacacc
cgttacgcaaattcacgcaagggctcgatttatatcgttaagccgaaaatgcatggttct
gaagaagtcgctttcgccaatgaattattcgaccgcgtcgaagatatgcttgggttgaaa
cgcaacacgattaaaatcggcgtcatggacgaagaacgtcgcacaacattgaacttgaaa
aactgcatttatcaagtgaaagaccgcatcgtcttcattaatacaggctttttggaccgg
actggcgatgaaatccatacatcaatggaagctggaccgatgattcgcaaaaatgatatg
aaaacatcagcgtggctgcaaggctatgaaaaatcaaacgtcagcattggcttggccact
ggattccaaggccgcgcccaaatcggcaaaggaatgtgggcgatgccggatatgatggcg
gaaatgctaaagcaaaaaggcgggcaactaaaagcgggcgcaaatacggcttgggtgcct
tcgccgacagctgcgacgctgcacgcgcttcactaccatcaaattaacgtcgctgaagtg
caagaggaattgcgaaaagagcagaaagattaccgtgatgaaattttgcaaataccagtt
gccgtgaacccgcaatggacgccggaagaaattcaagaagagcttgataacaactgccaa
ggcatactcggctacgtcgtccgctggatcgaccaagggatcggatgctcgaaggtgccg
gatattaataatatcggcctgatggaagaccgtgcgacattgcggatttccagccaacat
attgcaaactggctccaccacggcatttgcacgaaagaacaagtattggaaacgttaaaa
cggatggcaaaggtcgtcgacgaacaaaacgccggtgatccgaactatcgcccaatggct
cctgactatgacaattcggttgccttccaagcggcgtgcgacttaatatttaaaggttat
gaacagccaaacggctacaccgaaccgattttgcaccgccgccgtttagaggcaaaagca
aaatacgcagccattcaacaataa

DBGET integrated database retrieval system