KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1628Help
Entry
GY4MC1_1628       CDS       T01348                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:gmc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gmc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gmc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1598635..1600818
Genome map
AA seq 727 aa AA seqDB search
MGEYVKVGNLQVAKLLYEFINDEVLPGSEVNSETFWKDFETLIADLTPRNKALLARRDEI
QEKINQWHKEHRDNFNKEEYKAFLTEIGYLEPEVDDFEITTEGVDDEIAIQAGPQLVVPV
TNARYALNAANARWGSLYDALYGTDAISEEGGAERGDSYNPVRGAKVIAYAREFLDQAVP
LKEYSHKDAVQYAVVDGKLVVSVDGGKTTTLKEEEKFVGFQGNPENPTAVLLKNNGLHIE
IQIDRSHPVGKTDKAGVKDVYLEAAVTTIMDCEDSVAAVDAEDKVLVYRNLLGLVKGDLT
ATFTKDGKTITRELKPDRVYQTPDGKELTLPGRSLMFVRNVGHLMTNNAILDANGEEVYE
GIIDAVVTSLIMKHSLLGNTRYANSRKGSIYIVKPKMHGSEEVAFANELFDRVEDMLGLK
RNTIKIGVMDEERRTTLNLKNCIYQVKDRIVFINTGFLDRTGDEIHTSMEAGPMIRKNDM
KTSAWLQGYEKSNVSIGLATGFQGRAQIGKGMWAMPDMMAEMLKQKGGQLKAGANTAWVP
SPTAATLHALHYHQINVAEVQEELRKEQKDYRDEILQIPVAVNPQWTPEEIQEELDNNCQ
GILGYVVRWIDQGIGCSKVPDINNIGLMEDRATLRISSQHIANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPDYDNSVAFQAACDLIFKGYEQPNGYTEPILHRRRLEAKA
KYAAIQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatacgtaaaagttggaaatctccaagtcgcaaaactgctttatgagtttata
aacgatgaagtgcttccgggaagcgaagtgaacagcgaaacattttggaaagactttgaa
acgctgattgccgatttaacgccgagaaacaaagcgctgcttgcgcgccgcgatgaaatt
caagaaaaaataaatcaatggcataaagagcaccgcgacaattttaacaaggaagaatat
aaagcgtttttaacggagatcggctatttagagccagaagtggacgatttcgagattacc
accgaaggagtggacgatgaaattgccattcaagctggcccgcaattggtcgtgccggtt
acgaatgcccgctatgcgctgaatgcagcgaatgcccgttggggcagcctttatgatgcc
ttatatggaacagatgcgatcagcgaagaaggcggggcagaacgcggtgattcttacaat
ccggtccgtggggcaaaagtaattgcttatgcgcgcgagtttctcgatcaagccgtgccg
ctgaaagaatattcgcacaaagacgccgttcaatatgcggtagttgacggaaaactggta
gtatccgttgacggcggcaagacgacaacgctaaaagaggaagaaaaattcgtcggtttc
caaggaaacccggaaaatccgacggcggttttgttaaaaaataacggtcttcacatcgaa
attcaaattgaccgcagccaccctgtcggaaaaacggataaagcaggtgtgaaagatgtt
tatttagaagcggcggttacgacgattatggactgcgaagattcggtggcggcagttgac
gcggaagataaggtgctcgtataccgcaatttgctcggccttgtcaaaggagatttaacg
gcaacgttcacaaaagacggaaaaacgataacacgcgagctaaaaccggatcgcgtttat
caaacgccggatggtaaagaacttactctgccaggccgttcgcttatgttcgtccgcaac
gttggccatttgatgacgaacaatgcgattttggatgcaaacggcgaagaagtatatgaa
ggaatcatcgatgcggtcgtgacaagcttaattatgaaacattcgcttcttggcaacacc
cgttacgcaaattcacgcaagggctcgatttatatcgttaagccgaaaatgcatggttct
gaagaagtcgctttcgccaatgaattattcgaccgcgtcgaagatatgcttgggttgaaa
cgcaacacgattaaaatcggcgtcatggacgaagaacgtcgcacaacattgaacttgaaa
aactgcatttatcaagtgaaagaccgcatcgtcttcattaatacaggctttttggaccgg
actggcgatgaaatccatacatcaatggaagctggaccgatgattcgcaaaaatgatatg
aaaacatcagcgtggctgcaaggctatgaaaaatcaaacgtcagcattggcttggccact
ggattccaaggccgcgcccaaatcggcaaaggaatgtgggcgatgccggatatgatggcg
gaaatgctaaagcaaaaaggcgggcaactaaaagcgggcgcaaatacggcttgggtgcct
tcgccgacagctgcgacgctgcacgcgcttcactaccatcaaattaacgtcgctgaagtg
caagaggaattgcgaaaagagcagaaagattaccgtgatgaaattttgcaaataccagtt
gccgtgaacccgcaatggacgccggaagaaattcaagaagagcttgataacaactgccaa
ggcatactcggctacgtcgtccgctggatcgaccaagggatcggatgctcgaaggtgccg
gatattaataatatcggcctgatggaagaccgtgcgacattgcggatttccagccaacat
attgcaaactggctccaccacggcatttgcacgaaagaacaagtattggaaacgttaaaa
cggatggcaaaggtcgtcgacgaacaaaacgccggtgatccgaactatcgcccaatggct
cctgactatgacaattcggttgccttccaagcggcgtgcgacttaatatttaaaggttat
gaacagccaaacggctacaccgaaccgattttgcaccgccgccgtttagaggcaaaagca
aaatacgcagccattcaacaataa

DBGET integrated database retrieval system