KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1883Help
Entry
GY4MC1_1883       CDS       T01348                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gmc00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gmc00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:gmc00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:gmc00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:gmc00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1845542..1846537
Genome map
AA seq 331 aa AA seqDB search
MKDSFSTQIRARVSVLLNVKVRLKGDNFMSKVKVGILGSGNIGTDLMYKILNNDGHMELS
IIAGIVPESEGLMRARSMGIRASHEGIAAILEDPDVRIVFDATSAKAHRQNAEALRAAGK
IVIDLTPAAIGPFVVPPINLNEHINAWNVNMISCGGQATIPLVYAVSRIVSVQYAEVITT
TASRSIGPGTRQNMDEFTYTTAQGLQSIGGAKIARAIPVINSADPTIIMTNTVYAAVEED
FDEKAIILSIKDMVDEVSKYVPGYRLKATPFIDYRDTPWGRLPVVVILNEVEGSEDFLPA
YAGNLDIMTASARRVGESYAQHLLKMKEVRR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcattttctacacagatcagagccagagtatcggtcctgttgaacgtgaaa
gtcagactgaaaggggacaatttcatgagcaaagtgaaagttggaatcttaggttctggg
aatattggaacggatttgatgtacaaaatccttaataatgacggccatatggaattatct
ataatagctggaatcgtaccggaatcagaaggtcttatgagagcgcgaagcatgggcata
cgagccagccatgaaggaatagcggcgattttggaggatcccgatgtacggattgtcttt
gacgctacgagtgcaaaggcacatcgccaaaatgcggaagcgttacgtgcagcaggaaag
attgtgatagatttgacgcctgccgcaattggccctttcgtggtgcctcccatcaatttg
aatgagcatataaatgcttggaatgttaacatgatttcgtgcggaggacaggcgacaatt
cctctcgtttatgcagtaagtcgcattgtttctgtccaatatgcggaagtcatcacaact
accgccagccgctccataggccccggaacaagacaaaatatggatgagtttacctatact
accgcacaggggctgcaaagcatcggtggtgcgaagatagccagggcaattccggtgatt
aattcagcagatcccacaatcattatgacaaataccgtttatgccgcagtggaagaggat
tttgatgagaaagcgatcattttgtccattaaggacatggtcgatgaagtgtccaaatat
gttcctggatatcgcctcaaagcgactccatttatcgattatcgtgacacaccatgggga
agattgcctgtcgttgttatcttaaatgaagtcgaaggctcggaagattttcttccagca
tatgctggtaatttagacattatgacagcttcggcacggcgtgttggcgagtcatatgcc
cagcaccttctaaaaatgaaggaggtgagacgatga

DBGET integrated database retrieval system