KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1883Help
Entry
GY4MC1_1883       CDS       T01348                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GY4MC1_1883
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GY4MC1_1883
   00650 Butanoate metabolism
    GY4MC1_1883
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GY4MC1_1883
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GY4MC1_1883
   00622 Xylene degradation
    GY4MC1_1883
   00621 Dioxin degradation
    GY4MC1_1883
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GY4MC1_1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1845542..1846537
Genome map
AA seq 331 aa AA seqDB search
MKDSFSTQIRARVSVLLNVKVRLKGDNFMSKVKVGILGSGNIGTDLMYKILNNDGHMELS
IIAGIVPESEGLMRARSMGIRASHEGIAAILEDPDVRIVFDATSAKAHRQNAEALRAAGK
IVIDLTPAAIGPFVVPPINLNEHINAWNVNMISCGGQATIPLVYAVSRIVSVQYAEVITT
TASRSIGPGTRQNMDEFTYTTAQGLQSIGGAKIARAIPVINSADPTIIMTNTVYAAVEED
FDEKAIILSIKDMVDEVSKYVPGYRLKATPFIDYRDTPWGRLPVVVILNEVEGSEDFLPA
YAGNLDIMTASARRVGESYAQHLLKMKEVRR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcattttctacacagatcagagccagagtatcggtcctgttgaacgtgaaa
gtcagactgaaaggggacaatttcatgagcaaagtgaaagttggaatcttaggttctggg
aatattggaacggatttgatgtacaaaatccttaataatgacggccatatggaattatct
ataatagctggaatcgtaccggaatcagaaggtcttatgagagcgcgaagcatgggcata
cgagccagccatgaaggaatagcggcgattttggaggatcccgatgtacggattgtcttt
gacgctacgagtgcaaaggcacatcgccaaaatgcggaagcgttacgtgcagcaggaaag
attgtgatagatttgacgcctgccgcaattggccctttcgtggtgcctcccatcaatttg
aatgagcatataaatgcttggaatgttaacatgatttcgtgcggaggacaggcgacaatt
cctctcgtttatgcagtaagtcgcattgtttctgtccaatatgcggaagtcatcacaact
accgccagccgctccataggccccggaacaagacaaaatatggatgagtttacctatact
accgcacaggggctgcaaagcatcggtggtgcgaagatagccagggcaattccggtgatt
aattcagcagatcccacaatcattatgacaaataccgtttatgccgcagtggaagaggat
tttgatgagaaagcgatcattttgtccattaaggacatggtcgatgaagtgtccaaatat
gttcctggatatcgcctcaaagcgactccatttatcgattatcgtgacacaccatgggga
agattgcctgtcgttgttatcttaaatgaagtcgaaggctcggaagattttcttccagca
tatgctggtaatttagacattatgacagcttcggcacggcgtgttggcgagtcatatgcc
cagcaccttctaaaaatgaaggaggtgagacgatga

DBGET integrated database retrieval system