KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1992Help
Entry
GY4MC1_1992       CDS       T01348                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_1992
   00030 Pentose phosphate pathway
    GY4MC1_1992
   00051 Fructose and mannose metabolism
    GY4MC1_1992
   00052 Galactose metabolism
    GY4MC1_1992
   00500 Starch and sucrose metabolism
    GY4MC1_1992
   00520 Amino sugar and nucleotide sugar metabolism
    GY4MC1_1992
  Nucleotide metabolism
   00230 Purine metabolism
    GY4MC1_1992
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GY4MC1_1992
Enzymes [BR:gmc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GY4MC1_1992
    5.4.2.8  phosphomannomutase
     GY4MC1_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1965585..1967009)
Genome map
AA seq 474 aa AA seqDB search
MNFSMAQQQFVLPTHVFKEYDIRGRAGEELDENFAYLLGLAFAEMVRQAGEQKVVVGHDN
RISSPTLHRALIAGLSQASCQVIDIGLVTTPMFYYSLEYTNVPCGIIVTASHNPGDENGF
KIAMNKTTIYGERIQELRRIMERLQTQGVNRSDSWKEGYVEKLDIKPAYLEMLENKIKLG
ARKLKVVVDCGNGTASIIAPKALEAWGCEVVPLYCESDPTFPNHHPDPVVPENLQDLIDT
VRREKADVGLAFDGDGDRLGVVDEEGNIRWGDQLMILFWREILRRYPGADAPVEVKCSQA
LVEEIERLGGKPFFHRTGHSHIKATLRSRPEIPFAGEMSGHLFFNDEFYGYDDALYAAGR
LLRILSSDDRKLSQLFADVPSYHATPETRVPCPEEKKAEAIAAVKQRFADSHEVVDVDGA
RIQFKDGWGLVRPSNTQPILVLRAEAASPEALADIKQQLADVLSKPPLNLNITW
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcaatggcacaacaacaattcgttctaccaacacatgtgtttaaagagtac
gacattcgcggacgtgctggggaggaactggacgagaattttgcctacttgctaggattg
gcgtttgcggaaatggttcggcaagctggtgagcagaaggtagtggtcggccatgacaac
cgcatctcttctccaacattgcatcgtgcgctaattgcagggcttagccaggcatcatgc
caagtgatcgatatcggtctagtgacgaccccgatgttttattacagcctcgaatatact
aatgtgccgtgcggcatcatcgtcaccgctagccacaatcctggcgatgaaaacggattt
aagattgcgatgaataagacgaccatttacggcgagcgcatccaagaattgcggcggata
atggaacgtctccaaacacaaggggttaaccgcagcgattcgtggaaagaaggatatgtg
gagaaactcgacattaagccagcctatttagagatgttagaaaacaagatcaaactggga
gcgcgcaagcttaaagtagtggtcgactgcggtaacggaactgcttcgatcattgctccg
aaagcattagaggcatggggatgcgaggtcgtgcctttgtattgcgaatctgacccgacg
ttccctaatcaccatccggatccggtcgtgccagagaatttgcaagatttgattgatacg
gtgcggcgggaaaaggcggatgtcggtttggcgttcgacggcgatggagaccggcttgga
gtcgtcgatgaagagggaaacatccgctggggcgatcaattgatgattttattctggcgc
gagattctccgccgttatccgggagctgacgcgcctgttgaggtcaagtgctcgcaggcg
ttggtggaggaaattgaacggcttggcggcaaaccgttcttccatcgcactggccattcg
catattaaagcgacactgcgcagccgtccggaaattccgtttgccggcgagatgtctggc
catctgttcttcaatgacgagttctacggttatgatgacgccttgtacgcggcaggccgg
ctgttgcgtatcctatccagcgatgaccgcaaactgtcgcagctgtttgccgacgtccca
agttatcatgctactccggagacgcgcgtgccttgtccagaggagaaaaaggcagaagcc
atcgctgcggtaaaacagcggtttgcggacagccatgaagtcgttgatgtggacggcgcc
cgcattcagttcaaagacggctggggattggtgcgcccgtcaaatacgcagccaattctt
gtactgcgtgccgaagccgcgtcaccggaagcattggctgatattaaacaacagttggcc
gacgtgctttccaagccgccgcttaacttaaacatcacgtggtga

DBGET integrated database retrieval system