KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2001Help
Entry
GY4MC1_2001       CDS       T01348                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GY4MC1_2001
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GY4MC1_2001
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GY4MC1_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1978210..1978761
Genome map
AA seq 183 aa AA seqDB search
MSIYNYEVTKPNGETVSLSEYKGKVLLIVNTASRCGFTPQFQDLQKLYEKYREYGFEILG
FPCNQFGGQEPGSSQDAVAFCQRNYGVTFPIFAKIEVNGDNAHPLFQYLKKEAPFKGFDE
TNANGRILKLMIMEKNPEWLVGDEIKWNFTKFLINRDGKVIRRYEPIEEPIDFEQDIAAL
VNA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttacaattatgaagtgacaaaaccaaacggagaaacggtttctttgtctgaa
tataaaggaaaagtgttgctcattgttaatacagcgagccgctgcggatttacaccgcaa
tttcaagatttacaaaaattgtatgaaaaataccgtgaatatggatttgaaattcttggt
tttccgtgcaatcagtttggtgggcaggagccgggaagcagccaagatgccgttgctttc
tgtcaacgaaattacggggtaacttttcctatctttgccaaaattgaagtaaacggcgat
aacgctcacccattatttcaatatttgaaaaaagaagccccattcaaaggatttgacgaa
acaaacgcgaacggaagaattttgaaactgatgattatggaaaaaaacccggaatggtta
gttggggacgaaatcaaatggaacttcaccaaatttctcattaaccgcgacggcaaagtg
attcgccgatacgaaccaattgaagagccgatcgattttgaacaagacatcgcagcgctt
gtcaacgcctaa

DBGET integrated database retrieval system