KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2001Help
Entry
GY4MC1_2001       CDS       T01348                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gmc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gmc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1978210..1978761
Genome map
AA seq 183 aa AA seqDB search
MSIYNYEVTKPNGETVSLSEYKGKVLLIVNTASRCGFTPQFQDLQKLYEKYREYGFEILG
FPCNQFGGQEPGSSQDAVAFCQRNYGVTFPIFAKIEVNGDNAHPLFQYLKKEAPFKGFDE
TNANGRILKLMIMEKNPEWLVGDEIKWNFTKFLINRDGKVIRRYEPIEEPIDFEQDIAAL
VNA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttacaattatgaagtgacaaaaccaaacggagaaacggtttctttgtctgaa
tataaaggaaaagtgttgctcattgttaatacagcgagccgctgcggatttacaccgcaa
tttcaagatttacaaaaattgtatgaaaaataccgtgaatatggatttgaaattcttggt
tttccgtgcaatcagtttggtgggcaggagccgggaagcagccaagatgccgttgctttc
tgtcaacgaaattacggggtaacttttcctatctttgccaaaattgaagtaaacggcgat
aacgctcacccattatttcaatatttgaaaaaagaagccccattcaaaggatttgacgaa
acaaacgcgaacggaagaattttgaaactgatgattatggaaaaaaacccggaatggtta
gttggggacgaaatcaaatggaacttcaccaaatttctcattaaccgcgacggcaaagtg
attcgccgatacgaaccaattgaagagccgatcgattttgaacaagacatcgcagcgctt
gtcaacgcctaa

DBGET integrated database retrieval system