KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2042Help
Entry
GY4MC1_2042       CDS       T01348                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GY4MC1_2042
   00670 One carbon pool by folate
    GY4MC1_2042
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     GY4MC1_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2013957..2014445)
Genome map
AA seq 162 aa AA seqDB search
MISHIFAMDQNRVIGKDNRLPWHLPADLAYFKKVTMGHAVIMGRKTFQSLGRPLPGRENV
IVTRDRSFQAEGCTVLHSLEEVCQFAVKRGDEVFIIGGAELFQATLPVADRLYITKIEAS
FPGDTFYPDFDEAQWQLVSYTKGIKDEKNPYDYAFIVYERKH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatttcacatattttcgccatggatcaaaaccgcgtcattggcaaagataaccggcta
ccgtggcatttgcctgccgatttagcgtattttaaaaaagtaacgatgggacatgctgtt
atcatggggcggaaaacgtttcaatcgctcgggcggccgcttccgggaagagaaaatgtg
attgtcacaagggatcggtcgtttcaagcggaaggatgtacggtgctccattcgctcgaa
gaagtttgccagtttgccgtcaagcgcggcgatgaagtgtttatcattggcggcgcggaa
ttatttcaagcgacattgccagttgccgaccgtctttatattaccaaaattgaggcgagt
ttccccggcgatacgttttatcccgattttgatgaagcgcaatggcagctcgtttcctat
acgaaaggaatcaaagatgaaaaaaatccgtatgattatgcgtttatcgtttatgaacgc
aaacattaa

DBGET integrated database retrieval system