KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2184Help
Entry
GY4MC1_2184       CDS       T01348                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GY4MC1_2184
   00051 Fructose and mannose metabolism
    GY4MC1_2184
Enzymes [BR:gmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     GY4MC1_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2158878..2160203)
Genome map
AA seq 441 aa AA seqDB search
MPYFDNISTIAYEGPASKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG
AGNMIRPWNKYSGMDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDII
VDMIEEYMKTSKTKLLWNTANLFTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGA
ENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQ
YDFDVATALAFLQTYGLKDYFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDM
LLGWDTDEFPTDLYSTTLAMYEILKNGGLGRGGLNFDAKVRRGSFEPEDLFYAHIAGMDS
FAVGLKVAHRLIEDRVFDEFIEERYKSYTEGIGREIVEGTADFHKLEAHALQLGEIQNQS
GRQERLKTLLNQYLLEVCAAR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgccttattttgacaacatcagcaccatcgcctatgaaggaccggcgtctaaaaacccg
cttgcgtttaagttttacaatccggaagaaaaagtcggcgataaaacaatggaagagcat
ttgcgtttttcggttgcgtattggcatacgtttacaggagatggatcagatccgtttggg
gctggcaatatgatccgtccatggaacaaatacagcggaatggatttggccaaagcgcgt
gttgaagctgcttttgagttttttgaaaaattaaatattccatttttctgtttccatgat
gtggatattgccccagaaggagaaacattaaaagaaacatataaaaatttagatattatc
gtagacatgattgaagaatatatgaaaacaagcaaaacgaagctgctttggaatacggcg
aacttatttacccatcctcgctttgtccatggcgccgccacttcttgcaacgccgatgtt
tttgcctatgcagcggccaaagtaaaaaaagggttggaaattgcgaagcggctaggagcg
gaaaactacgtattttggggcggacgagaaggatatgaaacactattaaataccgatatg
aaacttgagctggacaacttggcccgcttcttgcatatggcggtggattatgcgaaagaa
atcgggtttgacgggcaatttttaattgagccgaagccgaaagagccgacgaaacaccaa
tatgactttgatgttgcgacagcattggcatttttgcaaacatacggactgaaagattac
tttaagttcaatattgaagcgaaccatgcaacgttggcgggacatacgtttgaacatgaa
ttgcgggtagcgcgcattcatggcatgttaggctctgttgacgcaaaccaaggagatatg
ttgttaggatgggatacggacgaattcccgacagacttatattctacgactttggcaatg
tatgaaattttgaaaaacggcggccttggccgtggcggtttgaattttgatgcgaaagta
agaagaggatcgtttgagccggaagatttgttctatgcccatatcgccggaatggacagt
tttgcggttggattaaaagtagcccatcggttaatagaagaccgcgtttttgatgagttt
attgaagaacggtacaaaagttatacagaaggaattggccgggaaatcgtcgaaggaacg
gcagatttccacaaattagaagcacatgctttacaactaggggaaatccaaaatcaatcg
ggcagacaagaacggctgaaaacattgcttaaccaatatttgcttgaagtttgcgcagcc
cgttaa

DBGET integrated database retrieval system