KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2208Help
Entry
GY4MC1_2208       CDS       T01348                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GY4MC1_2208
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GY4MC1_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2186959..2187930
Genome map
AA seq 323 aa AA seqDB search
MYKPKDSSQSPRFCGVRTFMRLENMKTTDNVDFVVLGVPFDTAASNRTGQRYGPQHIRNF
SVLLRPYNPDMDINIFEYCSGVDYGDIDVIPGNALRTYDHIVKELRPVLQKNIIPIIMGG
DHSITLGNLRAFHERFGPVALVHFDSHGDTWDHYYGEKYMHGTPFRRAVEEGLLDVDHSI
QIGMRGPLYSADDIEDARRLGFEVITMKEVRQIGFSEVMKRIHNRVGDKPVFVSYDIDFV
DPAFAPGTGTPEVGGPTSYEALEYVRGLDGLNIVGFDLVEVLPSYDSGEITAVLASAIIY
EMITLVALKKRRALQKNLSATTQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgtataaaccaaaagattcatcccaatctccacgcttttgcggagtccggacatttatg
cgcttagaaaatatgaaaacaacggacaatgttgattttgtcgtactcggtgtgccgttt
gatactgccgcttctaaccgaaccgggcaacggtatggaccgcagcacattcgaaatttt
tctgtattgcttcgcccttacaatccagatatggacattaatatctttgaatattgttct
ggagtagattatggagatattgacgtcattccaggaaacgcgctgcgaacatacgatcat
attgttaaagagttgcggccagtgttgcagaaaaatatcatcccgattattatgggcggc
gatcattcgattacattaggaaatttgcgggcatttcatgagcgctttgggccagtggcg
cttgttcatttcgactctcacggagatacttgggatcattattatggtgaaaaatatatg
catggcacgccattccgccgtgctgtcgaagaagggctgctggacgtggatcattccatt
caaatcggcatgcgcggaccgctttatagtgcggatgatatagaagatgcgcgacggctt
ggttttgaagtcattaccatgaaggaagttcggcaaattggattttctgaagtaatgaaa
cgcattcacaaccgtgtgggggataaacctgttttcgtttcctatgatatcgactttgtc
gatcctgcgtttgctcccggcaccggcacaccggaagtaggagggccaaccagctacgaa
gcactagagtatgtaaggggactcgatgggctaaatattgtcggatttgacctcgttgaa
gtattgccttcttatgacagcggggaaattacagctgtgttagcatctgccattatctat
gagatgatcacgctggttgcattaaagaaaagacgagccttgcaaaaaaatttatctgca
acaacacaatga

DBGET integrated database retrieval system