KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2393Help
Entry
GY4MC1_2393       CDS       T01348                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gmc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:gmc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2370969..2373065)
Genome map
AA seq 698 aa AA seqDB search
MLSFYKKITVILVAVVMLFVPWTSPQAHTEKEKPDLIIYQNIPEVNVKVNGNKISLRALH
VHREGYFTEVTEGLRWKSSNKRVAAVDDHGVVVFSGKNGRTLITVTDGARKDRIAFVVKT
APAANKNSKQNVKVTVGKEKGSRYDIIQKAINGLTLEEKIGQMLMPDFRNFAGKPVTAML
PEIKELVQTYHIGGVILFRENVVTTEQTAKLVADYQQAAEKFGLLMSIDQEGGVVTRLQS
GTNMPGNMALGAARSEQLAYKVGHAIGEELYALGINMNLAPVLDVNNNPDNPVIGVRSFG
ENPELVAELGMSYIKGLQDSGVAATAKHFPGHGDTAVDSHLGLPEVPHDRDRLQKVELYP
FQKAMEVGIDAIMTAHVTFPKVDDTKVISQKDGTEISLPATLSYKVLTELMREEMGFNGV
IITDAMNMKAISDHFGPVDAAVRAVQAGADIVLMPVGLEEVANGLKKAVQNGDISQKRIN
ASVKRILTLKVKRGIFKQETPPDTQDIVNHALRVVGSKEHKQVEAEAAAKSITLVKNGDA
LPIQANEVSNLVVVGNAMMESLEKTVRTYVPNATVIQAAAPLNEEQLQKVKEADAVIVGT
YTADVSGRLPSSPQMKMVQQIIDSTEAPVIAIGIRNPYDVMSYPNVDAYIAQYGFQQASF
QAAVDAIFGVNTPTGKLPVTIPSYDGGVLYEYGHGLTY
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcattttataaaaaaataactgttattttggtagcagtggtgatgctcttcgtt
ccatggacttcgccgcaagcgcataccgaaaaagagaagcccgacttgatcatttatcaa
aacattcctgaagttaatgtgaaagtgaatggaaacaaaatttcgttgcgggcgcttcat
gttcatcgggaaggatatttcaccgaagtcacagaaggattaaggtggaagtcatccaat
aaaagggtagctgccgttgatgatcacggtgtggttgttttttcaggaaaaaacggaaga
acgttgattacagtgacagatggggcacggaaagaccggatcgcttttgttgtcaaaacc
gctccggcagcgaacaaaaacagcaaacagaacgtgaaagtgaccgttggcaaagaaaag
gggagccgttatgatatcattcaaaaagcgataaatggcttaacgttggaagaaaaaatc
gggcaaatgctgatgccggatttccgcaatttcgctggaaagcctgtcactgccatgctt
ccggaaatcaaagaactggtacaaacatatcacattggcggtgtcattttattccgtgaa
aatgtagtgacgacggagcaaacggcaaagctcgtcgcggactatcagcaggcagcggaa
aagttcggtttgcttatgtcgatagaccaggaaggcggcgtcgtgacgcggctgcagtca
gggacaaatatgccagggaatatggcgctgggggcagcgcgttccgaacaacttgcttac
aaagtagggcatgcgattggcgaggaattatatgcgctaggcattaacatgaatttagca
cctgttttggatgtcaacaataatccggacaatccggtgatcggcgttcgttcgtttggc
gaaaatccagagcttgtcgcggagctagggatgtcttatatcaaaggattgcaagacagt
ggggttgctgctaccgccaagcatttcccaggacatggagataccgctgtcgattcccac
cttggcctgccggaagtgccgcacgaccgcgaccgtctccaaaaagtcgaattgtatccg
tttcaaaaagcgatggaagtgggaattgacgcgattatgactgcccatgtcacgttcccg
aaagtcgatgatacaaaggtgatttcgcaaaaagacggaacggaaatttcgcttcctgct
actttgtcgtataaagtgctgaccgagttaatgcgcgaagaaatgggctttaatggtgtc
attattaccgatgcaatgaatatgaaggcgattagcgatcattttgggccagtggatgcg
gcggtaagagcggttcaagccggtgctgatatcgtactgatgccggtggggctggaagaa
gtggcaaacgggttaaagaaagcagtgcaaaacggtgacatttcgcaaaaacgcatcaac
gcctccgtaaaacgaatattaacgctaaaagtgaaacgcggcattttcaagcaagaaaca
ccgcctgatacgcaagacattgtcaaccacgctttgcgcgttgtcggttcgaaggagcat
aaacaagttgaagctgaagcagcggcaaaatcgattacacttgtgaaaaacggcgatgca
ttgccgattcaagcaaatgaagtgagcaaccttgttgttgtgggaaatgcgatgatggaa
tcattagagaaaacggtacggacctatgttccaaatgcgactgtcatccaagcagcggct
cctttaaatgaagaacagctgcaaaaagtgaaagaagcagacgcggtcattgttggcacg
tatactgcggacgtctcaggaagattgccatcgagcccgcaaatgaaaatggtgcagcaa
atcatcgacagcaccgaagctcctgtcatcgcaattggaattcgcaatccgtatgatgtg
atgtcctatccgaatgtagatgcctacattgcgcagtacggttttcagcaggcaagtttc
caagcggcggtagatgcaattttcggagtaaatacaccgactggcaaacttccggtaacg
attccaagttatgatggcggcgtgctgtacgaatacggccatggtctcacttattaa

DBGET integrated database retrieval system