KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2498Help
Entry
GY4MC1_2498       CDS       T01348                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GY4MC1_2498
Enzymes [BR:gmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GY4MC1_2498
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GY4MC1_2498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2484062..2485552)
Genome map
AA seq 496 aa AA seqDB search
MEQYILSLDQGTTSSRAILFNQKGEIVHIAQREFKQYFPKPGWVEHNANEIWGSVLAVIA
TVLSETSIKPEQVAAIGITNQRETTVVWDKHTGLPVYNAIVWQSRQTADICGWLKQQGYD
DLFRQKTGLLIDPYFSGTKVKWILDNVDGAREKAEKGDLLFGTIDTWLIWKLSGGRAHVT
DYSNASRTLMFNIHTLQWDEEILTILGIPKSMLPEVRPSSEVYAKTIPHHFFGVEVPIAG
AAGDQQAALFGQACFEEGMAKNTYGTGCFMLMNTGEKAVQSKHGLLTTIAWGIDGKVEYA
LEGSIFVAGSAIQWLRDGLRMIKQAADSETYAEKVDSTDGVYVVPAFVGLGTPYWDSDVR
GAVFGLTRGTTKEHFIRATLESLAYQTKDVLTAMEADAGIALKTLRVDGGAVKNNFLMQF
QSDMLGVPVERPVINETTALGAAYLAGLAVGYWKDRKEIASQWQLERQFEPKMEKEKQEK
LYDGWKKAVKAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatacattttatcacttgaccaaggaacaacaagttcgcgcgcgattttgttc
aatcaaaaaggagagatcgttcatattgcgcagcgagaattcaagcaatattttccaaaa
ccgggatgggtcgagcataatgcgaatgaaatttggggatcggttttggcggtcattgcc
actgtcttgtcagagacatcgatcaagccggaacaagtagcggcgatcggcataaccaac
cagcgggaaacgacggtcgtatgggacaaacatacgggacttccggtttataacgcaatc
gtttggcaatcgcggcaaacggccgatatttgtggatggctgaagcaacaaggatatgat
gacttgttccgccagaaaaccggtttattaattgacccttatttttccgggacaaaagta
aaatggattttggacaacgtggacggggcgcgcgagaaagcggaaaaaggagatttattg
ttcggcacgatcgacacatggctgatttggaagctttcaggagggcgcgcgcatgtgacg
gattattcaaacgcttcacggacgcttatgtttaacattcatacattgcagtgggatgag
gaaattttaacgattttaggcattcctaaatcgatgcttccagaagtgcgcccgtcttcg
gaagtgtatgccaaaacgataccacatcacttttttggcgtcgaagtgccaattgccgga
gcagcaggcgaccagcaagcagcgctgtttgggcaagcatgctttgaggaaggaatggcg
aaaaacacatacggcaccggctgctttatgctgatgaacacaggagaaaaagcggtgcag
tcaaagcacgggctgttgacgacgatcgcgtgggggatcgacgggaaagtcgaatatgcg
ttagaaggaagcatttttgtcgctggctcggcgattcaatggcttcgcgacgggctgcgc
atgattaagcaggcggcagatagcgaaacgtatgcagaaaaagtcgattctaccgatggc
gtttatgtcgtgccggcgtttgtcggcctcggaaccccgtattgggacagcgatgtgcgc
ggcgccgtatttggcctgacacgcggaacgacaaaagaacatttcattcgcgcaacattg
gaatcgcttgcttaccaaacgaaagatgtattaaccgcgatggaagccgatgctggcatc
gcgctaaaaacgttacgcgtcgacggcggtgcggtgaaaaacaattttttaatgcaattc
caaagcgatatgctcggtgttccggtagaacgcccggtcatcaatgaaacgacggcgctt
ggcgcggcatatttagccggccttgctgtcggctattggaaagaccggaaagaaatcgct
tcgcaatggcaattggaacgtcaatttgaaccgaaaatggaaaaagaaaaacaggaaaag
ctatatgacgggtggaaaaaagcagtaaaagccgcaatggcgtttaagtaa

DBGET integrated database retrieval system