KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2533Help
Entry
GY4MC1_2533       CDS       T01348                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GY4MC1_2533
Enzymes [BR:gmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GY4MC1_2533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2515948..2516622
Genome map
AA seq 224 aa AA seqDB search
MEYLLSKDDVLKLSYISQKIVDKQLVVGPGGNISIRTNNIMWISPSGFALDQIQEDQWVP
VQIHNGQSLHPTLRPSSEIAMHLEIYRNRKDINAIVHTHPPITIGIISTEHNEIPAMFPD
FVALVGKVPFIEYVVPCSTELANSVINILQDPAYNALYLKNHGLITLGTNIMQAYYRTEI
IENAAKVFWVSKTVGTPRALLEHEIQEILNLEAEKYRQKLLERG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctgctttcaaaagacgatgttctaaaattaagctatattagccaaaaaata
gttgacaaacaattagtagtcggtcctggcggaaacattagtataaggactaacaatatt
atgtggatatcaccaagtgggtttgcattagatcaaattcaagaagatcaatgggtgccg
gtacaaattcacaacgggcaatctctccatcccactttaagaccctcatctgagattgct
atgcatttagaaatttatcgaaatcgaaaggatataaatgcgattgttcatactcatccc
ccgattacaatcggtatcattagtacagagcataatgaaatcccagcaatgtttcctgat
tttgtcgctctagttggaaaggttccttttattgaatatgttgttccctgctctaccgaa
ttagccaattctgttattaatattttgcaagatccggcatataatgctttatatttaaaa
aaccacggcttaattactttaggaacaaatatcatgcaagcgtattaccgtacggagatt
atagaaaatgccgcaaaagtattttgggtaagcaaaacggttggaaccccgcgagcttta
ctagaacatgaaattcaagaaatcctaaatcttgaggcggaaaagtaccgccaaaaatta
ctggaaaggggatga

DBGET integrated database retrieval system