KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2666Help
Entry
GY4MC1_2666       CDS       T01348                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gmc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gmc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2661701..2662759)
Genome map
AA seq 352 aa AA seqDB search
MSKVKVLVVDDSAFMRKLITNFLSESPQIEVVGTAKNGKEALEKAALLKPDVVTLDVEMP
VMNGLEALKQLMKNHPLPVVMLSSTTTEGAENTITAMQYGAIDFVAKPSGVISLDLYKVK
EELINKVLLASRANVRAISLDNTGEIRKHQRIRTIHDRKNQRKKIVCIGTSTGGPRALQQ
VLTKLPENIAAPIMVVQHMPKGFTKSLAQRLDSLSLIAVKEAEDGETLQNGTAYIAPGGF
HLLVHQEKGALTACVEQSPPRNGHRPSVDVLFESVSALTDYEKIAVIMTGMGSDGTAGLQ
RLKESGNTKVIAEDETTAVVFGMPKAAIQANVVDIVVPLEQIAEMIAKYVEG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtgaaagttctcgttgtggatgattccgcttttatgcggaagctgattact
aattttctttccgaaagcccacaaattgaagtagtcggaacggcgaaaaacggcaaggaa
gcgttggagaaagctgccttgctaaagccggatgttgtgacattggatgtcgagatgccg
gtgatgaatgggcttgaagcgcttaaacaattgatgaaaaaccatccgcttcctgttgtg
atgctatcaagcacgacgacagaaggcgcggaaaatacgatcactgcgatgcaatatggg
gcgatcgactttgtcgcgaaaccgtctggcgtcatttcgctagatttatataaagtgaaa
gaagaattgataaacaaggtgttgctggcaagccgcgccaacgtgcgggcgatatccttg
gacaacacgggcgaaataaggaaacaccaacggataagaacgattcatgatcggaaaaat
cagcgcaaaaaaatcgtttgcatcggaacgtcgacaggagggccacgcgcgttgcagcaa
gtgttgacgaaattgccggaaaatatcgccgcaccgattatggttgttcaacatatgcca
aaagggtttacaaaatcattggcgcaaaggcttgattcgctttcactgatcgccgtgaaa
gaggcggaagacggggaaacgctgcaaaacggcaccgcatatattgcgcccggcgggttt
catctattagtgcaccaagaaaaaggagcgcttactgcttgcgtggaacagtcgccgccg
cgaaacggccatcgcccatcagtagatgtgctgtttgagtcggtaagcgcattgacagac
tacgaaaaaatagcggtgattatgacagggatgggttcagacggaacggcgggattgcag
cgattgaaagaaagcggaaatacaaaagtgatcgctgaagatgaaacaacggcggtcgtg
tttgggatgccgaaagcagcgattcaagcaaacgtagtggatatcgttgtgcctttggag
caaatagcggaaatgattgctaaatatgttgaggggtaa

DBGET integrated database retrieval system