KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2741Help
Entry
GY4MC1_2741       CDS       T01348                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gmc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2729649..2730263)
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKALFSQPDINLHYSVSVTTREPREGEVDGVDYFFKTRE
EFEQMIRENKLLEWAEYVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAMQVRKVFPEGLF
IFLAPPSLSELEKRIISRGTESAEHIQNRLKAAKEELEMMDAYDYVVENDKVELACERIK
AIVMAEHCRRERVAKRYKRMLGVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagaggattattgattgtgctgtctggcccatctggtgtcggcaaaggaacg
gtgcggaaagcattgttttcgcagccggatattaatttgcattattctgtttccgtcacg
acgcgggaaccgcgggaaggcgaagtcgatggcgtcgattatttctttaaaacgcgcgaa
gaatttgagcaaatgattcgcgaaaacaaactgttggagtgggcggagtatgtcggcaat
tactatggaacgccgatcgactatgtggaaaaaacattgcaagaaggaaaagacgtgttt
ttggaaatcgaagtgcaaggcgcgatgcaagtgcgcaaagtgtttccggaaggcctcttc
atttttctcgcccctccaagtttaagcgaattggaaaagcgaattatatcacgcggcaca
gaatcggcagagcatatccaaaatcgtttgaaagcggcaaaagaagagctggaaatgatg
gatgcttacgattatgtcgtggaaaacgataaagtcgagctcgcgtgcgagcggattaaa
gcgatcgtgatggctgaacattgccggcgggaacgcgtggcaaaacgttataaaagaatg
ctgggggtggaataa

DBGET integrated database retrieval system