KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2754Help
Entry
GY4MC1_2754       CDS       T01348                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GY4MC1_2754
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GY4MC1_2754
Enzymes [BR:gmc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     GY4MC1_2754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2745341..2746264)
Genome map
AA seq 307 aa AA seqDB search
MHHLFTLTELSSAEITELLDEAERFAKGDHWQATEPLFVANLFFEPSTRTKCSFEMAERK
LGLHVIPFDADMSSMQKGETLYDTVRTLEAIGVNAVVVRHSQDAYFETLRHVIRIPIINA
GDGCGHHPTQSLLDLLTIRQEFGTLEGLTVAIIGDIRHSRVARSNAEVLARFGARVLFSS
PEEWKDAANPYGTYVDIDTAVAEADVVMLLRIQHERHEEKMGLTKEQYHARYGLTLERGE
KMKKNSIILHPAPVNRGVEIASELVESKRSRIFKQMENGVYVRMAVLKRAIEGGMANGSY
FKKWKIV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatttgtttacattgacagaattatcgtcagcagaaattaccgaattgttagat
gaagcggagcggtttgcaaaaggagatcattggcaggcaacagagcccctttttgtcgcc
aatttattttttgaaccgagcacgcgcacgaaatgcagttttgaaatggcggagcggaaa
ctcggacttcacgtcattccgtttgatgccgacatgtcgagcatgcaaaaaggggagacg
ctatatgacacggttcgcacgcttgaagcgatcggggtaaacgcggttgtcgtccgccat
tcgcaagatgcgtattttgaaacgcttcgccatgtgattcgcattccgatcattaacgcc
ggagacggttgcgggcatcatccgacacaatcgcttttagatttgcttaccatccgtcaa
gagtttggcacattggaaggattgacggtagcgattatcggcgatattcgccatagccgc
gtcgcccgttccaatgccgaggtgctggcaagattcggagcgagagtgttgttttccagt
ccagaagagtggaaagatgcggctaatccgtacgggacgtatgtggacatcgatacagcg
gtggcggaagcggacgttgtcatgctgctgcgcatccagcatgaacggcacgaagaaaaa
atggggctgacaaaagaacaatatcatgcacgctacggcctgacgctggaacggggagaa
aagatgaagaaaaacagcatcattttgcatccggcgccggtcaatcgcggcgtcgaaatt
gcgagcgaacttgtcgagtcgaaacgttcacgcatttttaaacaaatggaaaatggtgtt
tatgtgcggatggccgtgttaaaacgggcaattgaaggagggatggcgaatggcagttat
tttaaaaaatggaaaatcgtttaa

DBGET integrated database retrieval system