KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_2873Help
Entry
GY4MC1_2873       CDS       T01348                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GY4MC1_2873
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GY4MC1_2873
  Amino acid metabolism
   00310 Lysine degradation
    GY4MC1_2873
Enzymes [BR:gmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GY4MC1_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2853302..2854582)
Genome map
AA seq 426 aa AA seqDB search
MAEVKVPELAESITEGTIAQWLKKPGEYVEKGESICELETDKVNVEIMAEESGVLQQILA
REGDTVAVGQAIAVIGEGQAVQPAAQEAASKATPEAAQEAEAAAVSTEEKQEQPVAAGTH
PAQRPVASPAARKIAREKGIDLTQVPTVDPLGRVRKQDVESFAQQQSRPQAAPAAPVPQP
QQPAPSVAKQDDGKPVVREKMSRRRQTIAKRLLEVTQSTAMLTTFNEIDMSAVIALRKRK
KEKFFEEHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEIILKKYYDIGVAVSTDEGLV
VPVVRDCDRKNFAEIERDIAELAEKARNNKLSLSDLQGGTFTITNGGVFGSLFSTPLLNG
PQVGILGMHAIKLRPVAIDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTIKDLIENPE
DLLLES
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaagtcaaagttccagaattagcagaatccattacagaagggaccatcgcgcaa
tggttgaaaaagcctggtgagtatgtggaaaaaggtgaatcgatttgcgaattggaaaca
gataaagtcaatgttgaaattatggcggaagaatccggagtattgcaacaaattttagca
agggaaggagacacagtcgccgtagggcaagcgatcgctgtcattggcgaagggcaggct
gttcagccggctgcacaagaagcagcaagcaaagcaacgccagaagcagcgcaagaagcg
gaagcggcagcggtcagcacggaagaaaaacaggaacagccagtcgcggctggcactcat
ccggcacagcgcccggttgcttcgccggcagcgcgcaaaatcgcaagagaaaagggcatt
gatttaacacaagtccctactgttgatccgttaggccgtgtccgcaaacaagatgtggag
tcatttgcgcaacaacaatcaagaccgcaagcggcgccggcagcaccggttccgcagccg
cagcaaccagctccatctgtagcgaaacaagatgacggcaagccggttgtccgcgaaaaa
atgtcgcgccgccgccagacgattgccaaacgtttattggaagtaacgcaatctacggcg
atgttgacgacatttaatgaaatcgatatgtcggcggttatagcattgcgaaaacggaaa
aaagagaaatttttcgaagagcacgatgtgcgcctcgggtttatgtctttctttgtaaaa
gcggcggtagcggcattgaaaaaatatccttacgtcaatgcggaaattcaaggtgatgaa
attatcttgaaaaaatattacgatattggcgtcgctgtttccaccgacgaaggattggtt
gttccggtggtgcgcgactgcgatcggaaaaactttgctgaaatcgaaagagatattgct
gaattggctgaaaaagcgcgcaacaataaactatcgctaagcgacttgcagggcggaacg
tttacgataacaaacggtggagtgtttggttcgctgttttccactccgcttcttaatgga
ccgcaagtcggcattttaggaatgcatgccatcaagcttcgtcctgtggcaatcgacgaa
gagcgaatcgaaaatcgtccgatgatgtatgtcgcgttatcatatgatcatcgaattatt
gatggaaaagaagcggttggctttttgaaaacgatcaaagacttgatcgaaaatccagaa
gatcttcttttagaaagttaa

DBGET integrated database retrieval system