KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3092Help
Entry
GY4MC1_3092       CDS       T01348                                 

Definition
alcohol dehydrogenase GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GY4MC1_3092
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_3092
  Lipid metabolism
   00071 Fatty acid degradation
    GY4MC1_3092
  Amino acid metabolism
   00350 Tyrosine metabolism
    GY4MC1_3092
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GY4MC1_3092
   00626 Naphthalene degradation
    GY4MC1_3092
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GY4MC1_3092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3077672..3078694
Genome map
AA seq 340 aa AA seqDB search
MKAAVVEQFKEPLKIKEVEKPSISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVEEVGPGVTHLKVGDRVGIPWLYSACGHCEYCLSGQETLCEHQENAGYSVDGGY
AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGTKPGEWVAIYGIGGLGHVA
VQYAKAMGLHVVAVDIGDEKLELAKELGADLVVNPAKENAAQFMKEKVGGVHAAVVTAVS
KPAFQSAYNSIRRGGTCVLVGLPPEEMPIPIFDTVLNGIKIIGSIVGTRKDLQEALQFAA
EGKVKTIIEVQPLEKINEVFDRMLKGEINGRVVLTLENNN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtagtagagcaatttaaggaaccattaaaaattaaagaagtggaaaag
ccatccatttcatatggcgaagtattagtccgcattaaagcatgcggtgtatgccatacg
gacttgcacgccgctcatggcgattggccagtaaaaccaaaacttcctttaatccctggc
catgaaggagtcggaattgttgaagaagtcggtccgggggtaacccatttaaaagtggga
gaccgcgttggaattccttggttatattctgcttgcggccattgcgaatattgtttaagc
ggacaagagacattatgtgaacatcaagaaaacgccggctactcagtcgacgggggttat
gcagaatattgcagagctgcggcagactatgtggtgaaaattcctgacaacttgtcgttt
gaagaagctgctcctattttctgcgccggagttactacttataaagcgttaaaagtcaca
ggtacaaaaccgggagaatgggtagcgatctatggcatcggcggccttggacatgttgcc
gtccagtatgcgaaagcgatggggcttcatgttgttgcagtggatatcggcgatgagaaa
ctggaacttgcaaaagagcttggcgccgatcttgttgtaaatcctgcaaaagaaaatgcg
gcacaatttatgaaagagaaagtcggcggagtacacgcggctgttgtgacagctgtatct
aaacctgcttttcaatctgcgtacaattctatccgcagaggcggcacgtgcgtgcttgtc
ggattaccgccggaagaaatgcctattccaatctttgatacggtattaaacggaattaaa
attatcggttccattgtcggcacgcggaaagacttgcaagaagcgcttcagttcgctgca
gaaggtaaagtaaaaaccattattgaagtgcaacctcttgaaaaaattaacgaagtattt
gacagaatgctaaaaggagaaattaacggacgggttgttttaacgttagaaaataataat
taa

DBGET integrated database retrieval system