KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3718Help
Entry
GY4MC1_3718       CDS       T01348                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00071  Fatty acid degradation
gmc00350  Tyrosine metabolism
gmc00625  Chloroalkane and chloroalkene degradation
gmc00626  Naphthalene degradation
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_3718
  Lipid metabolism
   00071 Fatty acid degradation
    GY4MC1_3718
  Amino acid metabolism
   00350 Tyrosine metabolism
    GY4MC1_3718
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GY4MC1_3718
   00626 Naphthalene degradation
    GY4MC1_3718
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GY4MC1_3718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25 UDPG_MGDP_dh_N Methyltransf_11 Methyltransf_31 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADP76343
UniProt: A0A0F6BSE2
Position
3709613..3710635
Genome map
AA seq 340 aa AA seqDB search
MKAAVVNEFKQKLEIKEVEKPKLNYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEVAEGVKSVKVGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSADGGY
AEYCKAPANYVAKIPEHLDPVEVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVIAVDISDEKIELAKQLGADIAINGLKEDPVEAIQQNVGGAHAAISVAVT
KKAFEQAYQSVRRGGCLVVVGLPNEDLPIPIFNTVLNGITVKGSIVGTRKDMQEALDFAA
RGKVRPIVETAPLEKINEVFERMEKGKINGRVVLTIGVNR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcagttgtcaacgagtttaaacaaaaattagaaattaaagaggtggaaaaa
ccaaagctgaattacggagaggtgcttgttaaaattgaggcttgcggcgtttgccacacc
gatttgcatgcggcgcacggagactggccggtcaagccaaagcttcctttgattcctgga
cacgaaggggtaggcatcgtcgtcgaggtggcagaaggggtaaaatcggttaaagtagga
gaccgtgtcggcattccatggctgtactccgcttgcggagaatgtgaatattgtttgagc
gggcaagaaacgctttgtccgcatcaattaaatggcggatattctgccgatggaggatat
gcggaatactgcaaagcgcctgccaattatgtcgcaaaaattccggaacacttggatccg
gtggaagtcgcgcctattctttgcgcgggggtaacgacatacaaagcgctaaaggtatct
aacgccaaaccgggagaatgggtcgccatttacggaatcggagggttagggcatatcgcc
cttcaatacgcgaaagcaatgggattaaacgtcatcgcggtcgatattagcgatgaaaag
atagagcttgcgaaacaattaggcgctgatatcgccatcaatggacttaaagaagatcct
gtggaagccatccagcaaaacgtgggcggagcgcatgccgccattagcgttgccgtcacg
aaaaaagcgttcgaacaagcctatcaatccgtgagacgcggcggatgccttgttgttgtc
ggtctgcctaatgaagacttgccaattcctattttcaacacagtattaaatggaataacg
gtgaaaggatccatcgtcggcacgagaaaagatatgcaagaagcgttggatttcgccgcg
cggggaaaagtgcgcccgatcgtcgaaaccgctccattggaaaaaatcaatgaagtattt
gaaagaatggaaaaaggaaaaattaacggccgagtcgttttaaccatcggtgtcaaccgt
taa

DBGET integrated database retrieval system