KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_3793Help
Entry
GY4MC1_3793       CDS       T01348                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00071  Fatty acid degradation
gmc00350  Tyrosine metabolism
gmc00620  Pyruvate metabolism
gmc00625  Chloroalkane and chloroalkene degradation
gmc00626  Naphthalene degradation
gmc00650  Butanoate metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_3793
   00620 Pyruvate metabolism
    GY4MC1_3793
   00650 Butanoate metabolism
    GY4MC1_3793
  Lipid metabolism
   00071 Fatty acid degradation
    GY4MC1_3793
  Amino acid metabolism
   00350 Tyrosine metabolism
    GY4MC1_3793
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GY4MC1_3793
   00626 Naphthalene degradation
    GY4MC1_3793
Enzymes [BR:gmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GY4MC1_3793
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GY4MC1_3793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADP76416
UniProt: A0A0F6BSL5
Position
complement(3789749..3792352)
Genome map
AA seq 867 aa AA seqDB search
MAVEERVVDKKIEVAKMIDELVANAQKALEQFRAYDQETIDHIVKEMALAGLDKHMALAK
LAVEETKRGVYEDKIIKNLFATEYIYHNIKYDKTVGIIHENPHEEIIEIAEPVGVIAGIT
PVTNPTSTTMFKALISIKTRNPIIFAFHPSAQRCSSEAARVLRDAAVRAGAPEHCIQWIE
TPSLDATNQLMHHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIEKTANIKRAV
NDLILSKTFDNGMICASEQAVIIDKEIYEQVKKEMIENHCYFLNEEEKKKVEKLVINENT
CAVNPDIVGKPAYEIAKMAGIAVPEDTKILVAELKGVGPKYPLSREKLSPVLACYKVNST
EEGFKRCEEMLEFGGLGHSAVIHSDNQNVVTEFGKRMKAGRIIVNAPSSQGAIGDIYNAY
IPSLTLGCGTFGGNSVSTNVSAIHLINIKRMAKRTVNMQWFKVPPKIYFEKNAVQYLAKM
PDISRAFIVTDPGMVKLGYVDKVLYYLRRRPDYVHSEIFSEVEPDPSIETVMKGVDMMRS
FEPDVIIALGGGSPMDAAKAMWLFYEHPTADFNALKQKFLDIRKRVYKYPKLGQKAKFVA
IPTTSGTGSEVTSFAVITDKKTNIKYPLADYELTPDVAIVDPQFVMTVPKHVTADTGMDV
LTHAIEAYVSNMANDYTDGLAMKAIQLVFEYLPRAYQNGADELAREKMHNASTIAGMAFA
NAFLGINHSLAHKLGAEFHIPHGRANTILMPHVIRYNAAKPKKFTAFPKYEYFKADQRYA
EIARMLGLPARTTEEGVESLVQAIIKLAKQLDMPLSIEACGVSKQEFESKVEKLAELAFE
DQCTTANPKLPLVSDLVHIYRQAFKGV
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggaggagagagtcgtcgataaaaaaatcgaagtagcaaaaatgattgatgag
cttgtcgctaatgcacagaaagcgttggaacaatttcgcgcttacgatcaagaaacgatc
gatcatatcgtgaaagaaatggcgttagccgggctcgacaagcatatggcattagccaag
cttgcagtagaagaaacaaaacgcggtgtatatgaagataaaatcataaaaaaccttttt
gcgacagaatatatataccacaatattaagtatgataaaacagtcgggattattcatgaa
aatccgcatgaagaaattatcgaaattgctgagcctgttggtgttattgctgggattacg
ccagtgacaaacccgacatcgacaacgatgtttaaagcgttaatctcgataaaaacacgc
aacccgattattttcgctttccatccatcggcgcaacgatgcagcagcgaagcggcaaga
gtgctgcgcgatgcggcggtccgggcaggggctccagaacattgcattcaatggattgaa
actccttcgcttgatgcaaccaatcagcttatgcaccatcctggcgtttctctcattttg
gcaactggtggcgccggcatggtgaaagcagcgtacagctctggaaaaccagctttgggc
gtcggacctggcaatgtgccttgctatattgaaaaaacggcaaacataaaacgggcggta
aatgacttaattttatcgaaaacgtttgataacggcatgatttgcgcttctgaacaagca
gtcattattgataaagaaatttatgaacaagtaaagaaagaaatgatagaaaaccattgt
tatttcttaaatgaagaagaaaagaaaaaagtagaaaaactcgttatcaatgaaaataca
tgcgccgtcaacccggatatcgtcggaaagccagcttatgaaattgcgaaaatggccggc
atcgctgtgccggaagacacaaaaattcttgttgctgagttaaaaggggtcgggccaaaa
tatccgttgtctcgggaaaaattaagccctgtccttgcttgctataaagttaacagcacg
gaagaaggatttaagcgctgtgaagaaatgctggaatttggcggcttgggacattcggct
gtcatccattccgataatcaaaacgtggttaccgaatttggcaaacggatgaaagcggga
cggattatcgttaatgcgccatcttcgcaaggagcaatcggcgatatttacaatgcgtac
attccgtcattaacgctgggatgcggcacatttggcggaaactctgtttcgacaaacgtc
agtgcgattcatcttatcaatataaaaagaatggcaaaaaggacggtaaatatgcaatgg
tttaaagtgccgccgaaaatttatttcgaaaaaaatgctgtacaatacttagcgaaaatg
ccggatatttccagagcttttatcgtcaccgacccgggaatggtcaagctcggatatgtc
gataaagtgctgtattacttgcgcagacgcccggattatgtgcatagtgaaattttctcc
gaagtagagccagatccttcaattgagacggtaatgaaaggtgtcgatatgatgagaagt
ttcgagccggatgtgattatcgcgcttggaggcggctcgccaatggatgcggcaaaagcg
atgtggctcttttacgagcatccgacagcggatttcaacgcattaaaacaaaaattttta
gatattcgaaaacgcgtttataaatatccaaaactgggccaaaaagcgaaatttgtcgcc
attccgacgacatcaggaacaggatcggaagtaacgtcctttgccgtcattaccgataaa
aaaacgaatataaaatatccgttggcagattatgaattgacaccggacgtcgcgattgtg
gatccgcaatttgtcatgaccgtgccaaaacatgtcaccgccgatacgggaatggatgta
ttgacacatgcgatcgaagcgtatgtctccaatatggcaaatgattataccgatggtctt
gccatgaaagcaatccaactcgtatttgaatatttgccgcgggcatatcaaaacggagcg
gatgagcttgcccgggagaaaatgcataacgcctctacgattgcgggaatggcatttgcc
aacgcgtttttaggcattaaccatagtttggctcataaacttggcgcggaattccatatt
ccgcatgggcgcgcgaataccattttgatgccgcatgtcattcgctataacgcagcgaaa
ccgaaaaaatttaccgcatttccgaaatacgaatatttcaaagcggaccagcgctatgca
gaaattgcgagaatgctcggcttgccggcccgcacaacggaagaaggggtcgaaagcctc
gttcaggcgatcattaagctggcaaaacagttggatatgccgctgagcattgaagcatgc
ggcgtcagcaaacaagaatttgaaagcaaagttgaaaaattagccgaattggctttcgaa
gaccaatgtactactgctaacccgaaactcccgcttgttagcgatttagttcatatttat
cgccaagcgtttaaaggagtttaa

DBGET integrated database retrieval system