KEGG   Geobacter metallireducens: Gmet_0095Help
Entry
Gmet_0095         CDS       T00295                                 

Definition
hypothetical protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
gme  Geobacter metallireducens
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gme03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(119490..120203)
Genome map
AA seq 237 aa AA seqDB search
MTGLAAISDALAADLAGLSFSSPVAHVYNPLLYAREPHVAYLSRFGSPPKEVLFVGMNPG
PWGMAQTGVPFGEVAVVTEWLGINGTVTRPAGEHPKKRVDGFACRRSEVSGRRLWGFIRE
RFGTPERFFARFFVANYCPLLFLTAEGGNITPDKLRRGEQEPLFAACDLALRRTVVLLRP
RVVIGVGAFAEARCHEALEGFDVEVGRIIHPSPASPAANRDWAGTALRQLAELGVDF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtctcgcggctatttccgatgcccttgccgctgacctggcggggctttccttc
tcatcgccggtggcccacgtctacaatcccctcctctacgcccgggagccccatgtcgcc
tatctctcccgcttcggctcccctcccaaggaagtccttttcgtcggcatgaaccccggc
ccctgggggatggcccagaccggcgtccccttcggggaggtcgcggtggtgacggagtgg
ctcgggatcaacggcacggtcacgcggccggcgggcgagcaccccaaaaagcgggtcgac
ggctttgcctgccggcggagcgaggtgagcggccggcggctctgggggttcatccgggag
cggttcgggacgccggagcggttttttgcccgctttttcgtggccaactactgcccgctc
ctcttcctcaccgccgagggtggcaacatcaccccggacaaactgcgccggggagagcag
gagcccctcttcgccgcctgtgacctggccctgcgccggaccgtggtactgctccggcca
cgggtggtcatcggcgtcggagcgttcgccgaggcgcgctgccacgaggccctggagggc
tttgacgtggaggtggggcggatcattcaccccagccccgccagccccgctgccaaccgg
gactgggccggcacggccctgcgacaacttgcggagcttggtgtcgatttctga

DBGET integrated database retrieval system