KEGG   Geobacter metallireducens: Gmet_0095Help
Entry
Gmet_0095         CDS       T00295                                 

Definition
hypothetical protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
gme  Geobacter metallireducens
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:gme00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Gmet_0095
Enzymes [BR:gme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Gmet_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(119490..120203)
Genome map
AA seq 237 aa AA seqDB search
MTGLAAISDALAADLAGLSFSSPVAHVYNPLLYAREPHVAYLSRFGSPPKEVLFVGMNPG
PWGMAQTGVPFGEVAVVTEWLGINGTVTRPAGEHPKKRVDGFACRRSEVSGRRLWGFIRE
RFGTPERFFARFFVANYCPLLFLTAEGGNITPDKLRRGEQEPLFAACDLALRRTVVLLRP
RVVIGVGAFAEARCHEALEGFDVEVGRIIHPSPASPAANRDWAGTALRQLAELGVDF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtctcgcggctatttccgatgcccttgccgctgacctggcggggctttccttc
tcatcgccggtggcccacgtctacaatcccctcctctacgcccgggagccccatgtcgcc
tatctctcccgcttcggctcccctcccaaggaagtccttttcgtcggcatgaaccccggc
ccctgggggatggcccagaccggcgtccccttcggggaggtcgcggtggtgacggagtgg
ctcgggatcaacggcacggtcacgcggccggcgggcgagcaccccaaaaagcgggtcgac
ggctttgcctgccggcggagcgaggtgagcggccggcggctctgggggttcatccgggag
cggttcgggacgccggagcggttttttgcccgctttttcgtggccaactactgcccgctc
ctcttcctcaccgccgagggtggcaacatcaccccggacaaactgcgccggggagagcag
gagcccctcttcgccgcctgtgacctggccctgcgccggaccgtggtactgctccggcca
cgggtggtcatcggcgtcggagcgttcgccgaggcgcgctgccacgaggccctggagggc
tttgacgtggaggtggggcggatcattcaccccagccccgccagccccgctgccaaccgg
gactgggccggcacggccctgcgacaacttgcggagcttggtgtcgatttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system