KEGG   Geobacter metallireducens: Gmet_0384Help
Entry
Gmet_0384         CDS       T00295                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gme  Geobacter metallireducens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gmet_0384 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Gmet_0384 (hisD)
Enzymes [BR:gme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Gmet_0384 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
428430..429740
Genome map
AA seq 436 aa AA seqDB search
MKFLDIRDTNFDMEFAAILARGEETGREVEQVVLDIIADVRARGDEALLEYTRRFDRLEA
DSVASLQVTEDEVDYAFARVKDEEIAALKLAVERVARFHEKQKQETWLSTGEPDILLGQM
VTPLERVGIYVPGGKASYPSSVIMNAVPARVAGVGEVVMVAPTPGGEINPHVLVAARFSG
VDRIFRLGGAQAVAALAYGTATVPKVDKITGPGNIYVATAKKLVFGQVGIDMIAGPSEIL
VINDGSGTPAHIAADLLSQAEHDELASSILITTDRGFGERVAAEVERQLAELSRETIARR
SWETYGAVIVAGSLDEAIAFSNRIAPEHLELAVTNPFDVLPKIRNAGAIFLGHFTPEAAG
DYLAGPNHTLPTGGTARFFSPLSVDDFVKKSSIVYFSESGLNRLGGGIVRIAELEGLEAH
GRSVSVRLKGEGEARK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctcgatatcagggatacgaacttcgacatggaattcgccgccatcctcgcc
cggggcgaggagaccggccgcgaggtggaacaggtggtcctcgacatcatcgccgatgtc
cgtgcgcggggtgatgaggcgctcctggagtacacccggcgcttcgaccggcttgaggcc
gattccgtcgcctcgcttcaggtaaccgaggacgaggtcgactacgcctttgcccgggtg
aaggacgaggagatcgcggccctcaagctggcagtggagcgggtggcccgcttccacgag
aagcagaagcaggagacctggctctccaccggcgagcccgacatccttctcggccagatg
gtgactcccctggagcgggtcgggatctatgtccccggcggcaaagcgagctatccctcc
agcgtcatcatgaacgcggtaccggcccgggtggcgggcgtcggcgaggtcgtcatggtg
gccccgactcctggcggcgagatcaatccccatgtcctggtggcggcgcggttctccggc
gtggaccggatcttccgactcggcggcgcccaggccgtggcggccctggcctacggaacc
gccacggtgcccaaggtggacaaaatcaccggcccggggaacatctacgtggccacggcc
aagaagctggtcttcggccaggtggggatcgacatgatcgccggccccagcgagatcctc
gtcatcaacgacggaagcggcaccccggcccacatcgccgcagacctcctctcccaggcg
gagcacgacgaactcgcttcgtccatcctcatcaccaccgaccgcggcttcggcgagcgg
gtggcggcggaggtggagcggcaactggcggagctctcccgggagaccattgcccggaga
tcgtgggaaacgtacggtgccgtcatcgtggccggaagcctcgacgaggccatcgcgttc
agcaaccggatcgccccggagcacctggagctggccgtgacgaaccccttcgatgtcctg
ccgaaaatcaggaacgccggggccatcttcctcggtcactttactcccgaggcggcgggg
gattatctggccggtccgaatcacacccttcccaccggcggcacggcccggttcttctca
cctctgtcggtggacgatttcgtgaagaagtcctccatcgtctacttcagcgagagcggg
ttgaatcgtctgggggggggcatcgtccggatcgccgaactggaggggctggaagcccac
ggcaggtcggtgagcgtgagactgaagggggaaggagaggcccggaaatga

DBGET integrated database retrieval system