KEGG   Geobacter metallireducens: Gmet_0730Help
Entry
Gmet_0730         CDS       T00295                                 

Gene name
sucD-1
Definition
succinyl-CoA synthetase subunit alpha
Orthology
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
gme  Geobacter metallireducens
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gme01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gme00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gme00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:gme00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
802382..803257
Genome map
AA seq 291 aa AA seqDB search
MSILINKDSKIVVQGITGRSGLFHTQQCRDYGSRIVAGVTPGKGGIHIEGIPVFNTVEEA
VRYTGANVSMIFVPPPGAADAILEAADAGVDLAVCITEGIPVRDMVPVKRILQGSKTRLV
GPNCPGVITPGECKVGIMPGYIHKPGKIGVVSRSGTLTYEAVKQITEAGLGQSTCVGIGG
DPIIGMQFIDVLKLFNEDKQTEAVFMIGEIGGSAEEDAAEWIRENMKKPVAAFIAGVTAP
PGKRMGHAGAIITGGKGKAEDKIRTLGECGVVVAPSPTKMGAAMLEALGKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtccatactcatcaacaaggattcaaagatagtcgtccagggaatcacgggccgcagc
ggcctcttccacacccagcagtgccgggactatggctccaggatcgtggccggcgtcacc
ccgggcaagggggggatccacatcgaggggattccggtcttcaatacggtggaggaggcg
gtgcggtacaccggcgccaatgtctccatgattttcgttccaccccctggggccgccgac
gccatccttgaggcggccgacgcgggggtcgacctggcggtctgcatcaccgaagggatc
ccggtgcgcgacatggtgccggtgaagcggattctccaggggagcaagacccgcctcgtg
gggcccaactgccccggcgtcatcaccccgggcgagtgcaaggtggggatcatgcccggc
tacatccacaagcccggcaagatcggcgtcgtctcccgcagcggcaccctcacctacgag
gcggtgaagcagatcaccgaggcggggctcggccagtccacctgtgtcggcatcggcggc
gaccccatcatcggcatgcagttcatcgatgtcctgaagcttttcaacgaggacaagcaa
accgaggcggtcttcatgatcggcgagatcggcgggagcgccgaagaggacgccgccgag
tggatccgggagaacatgaagaagcccgtggccgccttcatcgccggggtcaccgccccc
ccgggaaagcggatgggccatgccggcgccatcatcaccggcgggaagggaaaggcggag
gacaagattcgcaccctgggcgagtgcggcgtggtcgtggccccgagccccacgaaaatg
ggggcggccatgctggaggcccttggcaagaagtaa

DBGET integrated database retrieval system