KEGG   Geobacter metallireducens: Gmet_0925Help
Entry
Gmet_0925         CDS       T00295                                 

Definition
nucleoside diphosphate-sugar dehydratase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
gme  Geobacter metallireducens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Gmet_0925
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gmet_0925
Enzymes [BR:gme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Gmet_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1019669..1020157
Genome map
AA seq 162 aa AA seqDB search
MQNFPEFKKGKIHDVAVRPLTKFLDERGWLAELFRSDETDAATMPAMAYLSMTQPGVARG
PHEHVDQTDWFCFIGPSNFKVYLWDARPTSATFGVKQTIYAGIDAPLAMIVPPGVVHAYK
NVGGENGIVFNAPNRLYAGEGKKSPVDEIRHEEVEGSPFTLD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactttcctgagttcaagaaagggaagattcacgatgtagcggtgcgccccttg
acgaaattcctcgacgagcgggggtggctcgccgaactgttccgcagcgatgaaaccgat
gctgccaccatgccggccatggcctatctctccatgacccagccgggggtagcccgggga
ccccacgagcacgtggaccagaccgactggttctgctttatcggtccctccaacttcaag
gtctatctctgggatgcccggcccacctctgccactttcggggtcaagcagaccatctat
gccggcatcgatgccccccttgccatgattgtccctcccggcgtggtccacgcctacaag
aacgtcggcggagagaacgggatcgttttcaacgcgccgaaccgtctctatgccggcgaa
gggaagaaatcgccggtggacgagatccggcacgaagaggtggaggggtctccctttacg
ctcgattga

DBGET integrated database retrieval system