KEGG   Geobacter metallireducens: Gmet_0938Help
Entry
Gmet_0938         CDS       T00295                                 

Gene name
pfk-2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gme  Geobacter metallireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gmet_0938 (pfk-2)
   01230 Biosynthesis of amino acids
    Gmet_0938 (pfk-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gmet_0938 (pfk-2)
   00030 Pentose phosphate pathway
    Gmet_0938 (pfk-2)
   00051 Fructose and mannose metabolism
    Gmet_0938 (pfk-2)
   00052 Galactose metabolism
    Gmet_0938 (pfk-2)
  Energy metabolism
   00680 Methane metabolism
    Gmet_0938 (pfk-2)
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gmet_0938 (pfk-2)
Protein phosphatases and associated proteins [BR:gme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gmet_0938 (pfk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1039789..1040748)
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRAAVRTAIRLNIEVVGFRKGYLGLMKGDAIPLDTKAVSGI
LHRGGTFLQSARSPEFKTPEGQQKAIDNLKELGVEGLVVLGGDGSLTGALALHRLGLPVV
GIPSSIDNDIPYTDMALGVDTALNNIIYAVDCIKDTASSHARAFVIEVMGRNSGYLASIS
AIATGAEFALVPEREYDLAEICQQLRARFEEGRDNAIIILAEGAGHAREISDSIKDAIGF
ETRITVLGHYQRGGAPTVFDRLLASRFGKRAVELLISGNSGVMVGLSCNAILATPLEDVI
KGEKRPQDEVLRLAEVLGV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcggcattctcacgagcggcggcgactgctccggcatgaacgccgccatc
cgggcggcggtacggaccgcgatccgcctgaacatcgaggtggtgggattcagaaaggga
tatctggggctcatgaagggggatgccatccccctcgacaccaaggcggtttcgggcatc
ctccaccggggtgggacgttcctccagtcggcccgctcgccggaattcaagacccccgag
gggcagcagaaggccatcgacaacctgaaggagttgggcgtcgaaggactcgtggtgctc
ggtggcgacggctccctaaccggcgccctggcgctccaccggctcggcctgccggtggtc
ggcatcccgtccagcattgacaacgacatcccctacaccgacatggccctcggtgttgat
acggccctcaacaacatcatctacgccgtcgactgcatcaaggatacggccagctcccac
gcccgggcctttgtgatcgaggtcatggggcgcaactcggggtacctggccagcatctcc
gccatcgccaccggtgccgagttcgccctggtccccgaacgggaatacgacctggccgag
atctgccaacagctccgagcacgcttcgaggaggggcgcgataacgccatcatcatcctc
gccgaaggcgccggccatgcccgggagatctccgacagcatcaaggacgccatcggcttc
gagacgcggatcacggtgctgggccactaccagcgcggcggcgcgccgaccgtcttcgat
cggctcctggcaagccgtttcggcaagcgggcggtggaactcctcatctccggcaactcc
ggggtgatggtgggactttcctgcaatgccattctcgccacgcccctggaagacgtcatc
aaaggcgagaaacgcccccaggacgaggtattgcggctggcagaggtgttaggtgtttag

DBGET integrated database retrieval system