KEGG   Geobacter metallireducens: Gmet_1150Help
Entry
Gmet_1150         CDS       T00295                                 

Definition
protein disulfide bond isomerase, DsbC/DsbG-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gme  Geobacter metallireducens
Brite
Enzymes [BR:gme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Gmet_1150
Secretion system [BR:gme02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Gmet_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1276759..1277562
Genome map
AA seq 267 aa AA seqDB search
MRLQLLRFVGALSLTACLAAPTAFAAPKEQAKGETPEAAVKRLFPKLPATAVKKTDIDGF
YEVVADGNILYVNVKTGHVFVGDIFTREGKNLTAEARTRLTAERYKLITEADKEKAVKVG
NGKHVVIEITDPDCPFCRKMHEYWGNRPDVTRYVFFLPLAMHKDAEKKARYILAADNKEQ
ALWEVYSGELDNNREKLNKPYDDKGLLSAHKAVVAKLGIQSTPAFWVDGTFVNGANIPLI
EKIIGKCNLRQGTAPGEPKVCDDEQGK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttcaactgttacgattcgtgggggcactttccctgacagcgtgcctcgctgca
ccgactgcctttgcggcgccgaaagaacaagccaagggggaaacccctgaggcggccgta
aaacggctctttccgaagcttcccgccaccgcggtgaaaaaaaccgatatcgacgggttc
tatgaggttgtggctgacgggaatattctctatgtcaacgtgaagaccggtcacgtgttt
gtgggtgacatttttacgcgggaggggaaaaacctgacggccgaggctcgcacccgcctc
actgccgagcgctataagctcattaccgaggccgacaaagagaaggcggtgaaggtgggg
aacggcaagcatgtggtcatcgagatcaccgaccccgactgccccttctgccgcaagatg
catgagtactggggaaaccgtcccgatgtgacgcgttatgttttcttcctcccccttgcg
atgcataaggatgctgaaaagaaggcccgctatatcctggcggccgacaataaggaacaa
gccctctgggaggtctattcgggggaactcgacaataaccgcgagaagctgaacaagccc
tatgacgacaaggggttgctctccgcgcacaaggcggtggtggcaaagctcggcatccag
tcgacccctgccttctgggtagacggtacttttgtgaatggcgcgaatatcccgcttatc
gaaaagatcatcggcaagtgcaacctccggcaaggaactgctccaggtgagccgaaggtg
tgcgatgatgagcaggggaagtga

DBGET integrated database retrieval system