KEGG   Geobacter metallireducens: Gmet_1159Help
Entry
Gmet_1159         CDS       T00295                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gme  Geobacter metallireducens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gmet_1159 (galU)
   00052 Galactose metabolism
    Gmet_1159 (galU)
   00500 Starch and sucrose metabolism
    Gmet_1159 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Gmet_1159 (galU)
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Gmet_1159 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1285171..1286046)
Genome map
AA seq 291 aa AA seqDB search
MQVKKAVFPVAGLGTRFLPATKASPKEMLPLIDKPLVQYVVEEAVAAGIEQILFVTGRGK
RAIEDHFDISFELEALLQEKGKNDTLREVRDIAEMVNIFYVRQKQAMGLGHAILCAREFV
GNEPFAVLLGDDIIDAEKPCLGQLLDVYRKYRGPVLALEKVPMENISSYGCVRANGITDR
IFEVTDLVEKPKREEAPSDMAIIGRYVLTPEIFPILERQEPGKGGEIQLTDALLKLSKDE
AIYGCLFEGIRHDCGDKLGFLKATVDMALKREEFNTEFEEYLRERLCRRQD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaaaaaaggcagtcttccccgtggcgggcctcggcacccgcttccttccggcc
accaaggcttcacccaaggagatgctccccctcatcgacaagcccctggtccagtacgtg
gtggaagaggcggtggctgccggcatcgaacagatactcttcgtgaccggccgcggcaag
cgggccatcgaggaccacttcgacatctccttcgagttggaggcgctcctccaggaaaag
gggaagaacgataccctccgcgaagtgcgggacatcgccgaaatggtgaacatcttctac
gttcgccagaagcaggccatggggcttggccatgcaatcctctgcgcccgggagttcgtg
ggtaacgagccctttgccgtgctcctcggcgacgacatcatcgatgccgagaaaccgtgc
ctcggccagcttctggatgtctaccgcaagtaccgggggccggttctcgccctggaaaag
gtgcccatggagaacatatcctcctacggctgcgtcagggccaacggcataaccgaccgt
atcttcgaggtcaccgatctggtggaaaagccgaaacgggaggaggccccctcggacatg
gccatcatcggccgctatgtcctcacccccgagatatttccgatcctggagcggcaggaa
ccgggcaaggggggggaaatccagctcaccgacgccctcctcaagctctcgaaggacgag
gcgatttacggctgcctctttgaggggatacgccacgattgcggtgacaaattgggattc
ctgaaggccacggttgacatggcgctcaagcgggaagagttcaatacggaatttgaggag
tatctgcgggaacgactgtgcagaaggcaggattga

DBGET integrated database retrieval system