KEGG   Geobacter metallireducens: Gmet_1631Help
Entry
Gmet_1631         CDS       T00295                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gme  Geobacter metallireducens
Pathway
gme00260  Glycine, serine and threonine metabolism
gme00750  Vitamin B6 metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gmet_1631 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gmet_1631 (thrC)
Enzymes [BR:gme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gmet_1631 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABB31862
JGI: Gmet1631
UniProt: Q39V62
Position
complement(1827511..1828896)
Genome map
AA seq 461 aa AA seqDB search
MNYISTRGAIAPIGFKDAVMMGLATDGGLLLPETIPALGRNTLESWQSLSYQDLAFNVIS
LFADDIPAQDLKDLIDRSYATFSHPEITPVVEKDGVYILELFHGPTLAFKDVALQLLGNL
FEYLLKERGEKMNIVGATSGDTGSAAIYGVRGKDKINIFILHPHGKTSPVQALQMTTVLD
PNVHNIAARGTFDDCQNIVKSLFSDLPFKEKYSLGAVNSINWARVLAQVVYYFYAYFRVA
ALFGQEVVFSVPTGNFGDIFAGYVAKRMGLPIRRLILATNENNILSRFINGGDYSLGDVV
ATVSPSMDIQLASNFERYVYYLFGENPARVREAFAALPTKGRIDFTEAEMEKVRDEFLSR
SVNEDETIATIAAFHRETGYILDPHTAVGVKAALELVQDGTPAVCLATAHPAKFAEAVVR
AVGFEPSRPTSLEGIEALPSRCDVLDADRDAIKAFIEKKAL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatcagtacccggggtgccatcgcccccatcggattcaaggacgcggtcatg
atgggactcgccaccgacggcgggcttctgctgccggagaccatcccggcccttggccgc
aacacgctcgaatcgtggcaaagcctctcctaccaggatctggcgttcaacgtgatatcc
ctcttcgccgatgacattcccgcgcaggacctcaaggatctcatcgaccgctcctacgcc
accttctcccatccggagattacaccggtggtggaaaaggacggtgtgtacatcctggaa
ctcttccacgggccgacccttgccttcaaagacgtggcgctgcagctcctcggcaacctc
ttcgagtacctgctgaaggagcgcggggaaaagatgaacatcgtcggcgccacctcgggc
gacaccggcagtgccgccatctacggcgtccggggaaaggacaagatcaacatcttcatc
ctccatccccacggcaagacctcgccggtgcaggccctgcagatgaccacggtgctcgat
ccgaacgtgcacaacatcgccgcgcgggggacctttgacgactgccagaacatcgtgaag
agcctcttcagcgatctccccttcaaggaaaagtactccttgggcgccgtcaactccatc
aactgggcccgggtcctggcccaggtggtctactacttctacgcctacttccgggttgcc
gcgctcttcggccaggaggtggtcttctcggttccgaccggcaatttcggcgatattttc
gccggctacgtggcaaagcggatgggtctgccgatcagacggttgatcctggccaccaac
gagaacaatatcctctcccggttcatcaacgggggtgactattccctcggagacgtggtg
gcgaccgtatccccgtccatggatatccagctggcctccaacttcgagcggtatgtctac
tacctcttcggcgagaaccccgcccgggtccgcgaggcgttcgccgccctccccacgaag
gggcggatcgacttcaccgaggccgaaatggagaaggtgcgggatgagttcctctcccgc
tcggtgaacgaggatgagaccatcgcgaccatcgccgcctttcaccgggagaccggctac
atcctcgacccccacacggcggtcggcgtcaaggcggccctggaactggtgcaggacggc
actcccgccgtctgcctcgccacggctcacccggccaagttcgccgaggcggtggtccgt
gccgtgggtttcgagccttcccgaccgacctccctggaaggaatcgaagcccttccgagc
cgatgcgacgtgctcgatgcggaccgcgacgccataaaggcattcatcgagaaaaaggcc
ctgtag

DBGET integrated database retrieval system