KEGG   Geobacter metallireducens: Gmet_1631Help
Entry
Gmet_1631         CDS       T00295                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gme  Geobacter metallireducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gmet_1631 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gmet_1631 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gmet_1631 (thrC)
Enzymes [BR:gme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gmet_1631 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1827511..1828896)
Genome map
AA seq 461 aa AA seqDB search
MNYISTRGAIAPIGFKDAVMMGLATDGGLLLPETIPALGRNTLESWQSLSYQDLAFNVIS
LFADDIPAQDLKDLIDRSYATFSHPEITPVVEKDGVYILELFHGPTLAFKDVALQLLGNL
FEYLLKERGEKMNIVGATSGDTGSAAIYGVRGKDKINIFILHPHGKTSPVQALQMTTVLD
PNVHNIAARGTFDDCQNIVKSLFSDLPFKEKYSLGAVNSINWARVLAQVVYYFYAYFRVA
ALFGQEVVFSVPTGNFGDIFAGYVAKRMGLPIRRLILATNENNILSRFINGGDYSLGDVV
ATVSPSMDIQLASNFERYVYYLFGENPARVREAFAALPTKGRIDFTEAEMEKVRDEFLSR
SVNEDETIATIAAFHRETGYILDPHTAVGVKAALELVQDGTPAVCLATAHPAKFAEAVVR
AVGFEPSRPTSLEGIEALPSRCDVLDADRDAIKAFIEKKAL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatcagtacccggggtgccatcgcccccatcggattcaaggacgcggtcatg
atgggactcgccaccgacggcgggcttctgctgccggagaccatcccggcccttggccgc
aacacgctcgaatcgtggcaaagcctctcctaccaggatctggcgttcaacgtgatatcc
ctcttcgccgatgacattcccgcgcaggacctcaaggatctcatcgaccgctcctacgcc
accttctcccatccggagattacaccggtggtggaaaaggacggtgtgtacatcctggaa
ctcttccacgggccgacccttgccttcaaagacgtggcgctgcagctcctcggcaacctc
ttcgagtacctgctgaaggagcgcggggaaaagatgaacatcgtcggcgccacctcgggc
gacaccggcagtgccgccatctacggcgtccggggaaaggacaagatcaacatcttcatc
ctccatccccacggcaagacctcgccggtgcaggccctgcagatgaccacggtgctcgat
ccgaacgtgcacaacatcgccgcgcgggggacctttgacgactgccagaacatcgtgaag
agcctcttcagcgatctccccttcaaggaaaagtactccttgggcgccgtcaactccatc
aactgggcccgggtcctggcccaggtggtctactacttctacgcctacttccgggttgcc
gcgctcttcggccaggaggtggtcttctcggttccgaccggcaatttcggcgatattttc
gccggctacgtggcaaagcggatgggtctgccgatcagacggttgatcctggccaccaac
gagaacaatatcctctcccggttcatcaacgggggtgactattccctcggagacgtggtg
gcgaccgtatccccgtccatggatatccagctggcctccaacttcgagcggtatgtctac
tacctcttcggcgagaaccccgcccgggtccgcgaggcgttcgccgccctccccacgaag
gggcggatcgacttcaccgaggccgaaatggagaaggtgcgggatgagttcctctcccgc
tcggtgaacgaggatgagaccatcgcgaccatcgccgcctttcaccgggagaccggctac
atcctcgacccccacacggcggtcggcgtcaaggcggccctggaactggtgcaggacggc
actcccgccgtctgcctcgccacggctcacccggccaagttcgccgaggcggtggtccgt
gccgtgggtttcgagccttcccgaccgacctccctggaaggaatcgaagcccttccgagc
cgatgcgacgtgctcgatgcggaccgcgacgccataaaggcattcatcgagaaaaaggcc
ctgtag

DBGET integrated database retrieval system