KEGG   Geobacter metallireducens: Gmet_1639Help
Entry
Gmet_1639         CDS       T00295                                 

Definition
ROK domain transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gme  Geobacter metallireducens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gmet_1639
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gmet_1639
   00052 Galactose metabolism
    Gmet_1639
   00500 Starch and sucrose metabolism
    Gmet_1639
   00520 Amino sugar and nucleotide sugar metabolism
    Gmet_1639
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gmet_1639
   00524 Butirosin and neomycin biosynthesis
    Gmet_1639
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gmet_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1838882..1839856
Genome map
AA seq 324 aa AA seqDB search
MNGNKRAYIGIDIGGTNLRMALIDERGAIIHKTKSRTDIHHGRSSFLSRLGKGIESLLLA
ARDNNIEPAGLGAGVPGLIANDGHVYVSVNLRPLDGVNLRDELQAMSGLPAVVANDVNAF
AFGESVYGAGRDYRSFLMVTLGTGVGGGLILDGKVWSGIDGVAGEFGHMTVESEGRPCPC
GNRGCLEQYASASALVSAAREMICQQKDVFGAQCDMDAISTKILAAAALDGNQAALGLFA
DAGRYLGIAAASVANLLNLEAIILGGGVSSSFNLLCESMRREVLARAFPIPGKRLVIRQA
SLGDDGGILGSAALARSFLQEGKP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcaacaagcgcgcctatatcggcatagacataggaggtaccaatctccgcatg
gctctcattgatgaacggggcgccattatccacaaaaccaagagcaggaccgatatccac
catggtcgatcctctttcctctcgcgccttggcaaggggattgagtccctgctgctcgcg
gccagagataataacatcgaacctgccgggctgggggcaggggtgccgggactcattgcc
aatgacggccatgtgtatgtttcggtgaacctcaggccattggacggggtaaatctgcgg
gatgagcttcaggccatgagcgggctccccgcagtggtggcgaacgatgtaaacgcgttt
gccttcggagagagcgtctacggggcgggcagggactatcggtcatttcttatggttacc
ctcggcactggcgttgggggaggtctgatcctcgacggcaaggtctggagcggaatcgac
ggggtggcaggcgagtttggccacatgaccgtggaatccgaggggaggccctgtccctgc
ggcaaccgcggttgtctcgagcagtacgcatccgcaagcgccctggtttccgcggcaaga
gagatgatctgccaacagaaggatgtattcggggcgcaatgcgacatggacgccatttca
accaaaatacttgccgctgcggcactggacggtaaccaggcggcgttgggcctcttcgcc
gatgccggacggtatctggggatcgctgccgcgtcggttgccaatctccttaatctcgaa
gcgataattctcgggggaggagtctcctcgagtttcaacctcctgtgcgagagcatgaga
cgggaagttcttgccagggcctttcccattccgggcaagcgcctcgttatccgccaggct
tccctgggagacgacggtgggattctcggcagtgccgcactggcaaggagttttcttcag
gaggggaaaccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system