KEGG   Geobacter metallireducens: Gmet_1639Help
Entry
Gmet_1639         CDS       T00295                                 

Definition
ROK domain transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gme  Geobacter metallireducens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:gme01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gme00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gme00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gme00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gme00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gme00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1838882..1839856
Genome map
AA seq 324 aa AA seqDB search
MNGNKRAYIGIDIGGTNLRMALIDERGAIIHKTKSRTDIHHGRSSFLSRLGKGIESLLLA
ARDNNIEPAGLGAGVPGLIANDGHVYVSVNLRPLDGVNLRDELQAMSGLPAVVANDVNAF
AFGESVYGAGRDYRSFLMVTLGTGVGGGLILDGKVWSGIDGVAGEFGHMTVESEGRPCPC
GNRGCLEQYASASALVSAAREMICQQKDVFGAQCDMDAISTKILAAAALDGNQAALGLFA
DAGRYLGIAAASVANLLNLEAIILGGGVSSSFNLLCESMRREVLARAFPIPGKRLVIRQA
SLGDDGGILGSAALARSFLQEGKP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcaacaagcgcgcctatatcggcatagacataggaggtaccaatctccgcatg
gctctcattgatgaacggggcgccattatccacaaaaccaagagcaggaccgatatccac
catggtcgatcctctttcctctcgcgccttggcaaggggattgagtccctgctgctcgcg
gccagagataataacatcgaacctgccgggctgggggcaggggtgccgggactcattgcc
aatgacggccatgtgtatgtttcggtgaacctcaggccattggacggggtaaatctgcgg
gatgagcttcaggccatgagcgggctccccgcagtggtggcgaacgatgtaaacgcgttt
gccttcggagagagcgtctacggggcgggcagggactatcggtcatttcttatggttacc
ctcggcactggcgttgggggaggtctgatcctcgacggcaaggtctggagcggaatcgac
ggggtggcaggcgagtttggccacatgaccgtggaatccgaggggaggccctgtccctgc
ggcaaccgcggttgtctcgagcagtacgcatccgcaagcgccctggtttccgcggcaaga
gagatgatctgccaacagaaggatgtattcggggcgcaatgcgacatggacgccatttca
accaaaatacttgccgctgcggcactggacggtaaccaggcggcgttgggcctcttcgcc
gatgccggacggtatctggggatcgctgccgcgtcggttgccaatctccttaatctcgaa
gcgataattctcgggggaggagtctcctcgagtttcaacctcctgtgcgagagcatgaga
cgggaagttcttgccagggcctttcccattccgggcaagcgcctcgttatccgccaggct
tccctgggagacgacggtgggattctcggcagtgccgcactggcaaggagttttcttcag
gaggggaaaccatga

DBGET integrated database retrieval system