KEGG   Geobacter metallireducens: Gmet_1640Help
Entry
Gmet_1640         CDS       T00295                                 

Gene name
pfk-1
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gme  Geobacter metallireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:gme01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gme01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gme00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gme00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gme00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gme00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:gme00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1839853..1840944
Genome map
AA seq 363 aa AA seqDB search
MKRKIGILTGGGDCPGLNAVIRGVVKSAIIGRGWEVVGIEDGFDGLLYDRTPRPLGLEDV
RGILPRGGTILGTSNRGNPFSYPIEVNGKTVLTDVSDRVVERVKDLGIDAIVAVGGDGSL
KIALELMKRGVPVVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRIMIM
EVMGRYAGWIALESGISGGADVILIPEIPFELKAVCNAIEGRRRRGSKFSIVVAAEGAFP
RGGTRVVQKKADETMAIERLGGIGNFVAHELTSCLDMDIRVTVLGHLQRGGSPSTFDRCL
GSRFGIGAVELIEREQYGEMICLKGRAIRSVPIEKAVRKLKLVDPRGQMVTAAKELGINV
GRE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaagatcggcatccttacgggagggggagactgtcccggcctcaacgcggtg
atacggggcgtggtgaagagcgccatcatcgggaggggatgggaggtggtcggtatcgag
gacggattcgacggccttctctacgaccgaacccccagaccactggggcttgaagacgtg
aggggaatccttccgcggggaggaacgatccttggcacctccaataggggcaatcccttt
tcctaccccattgaggttaacggtaaaactgtgctgactgatgtgtccgaccgggttgtg
gagcgggtcaaggacctcgggatcgacgccatcgtggcagtggggggagatggttccctc
aagatcgccctggagttgatgaaaaggggggtgccggtggttggcgtcccgaagacaatt
gacaacgatctaatggaaaccgatgtcacctttggttacaacacggccctggaaacagcc
actgatgccctcgacaagctccattcgacggccgagagccatcaccgtatcatgatcatg
gaggtgatggggcgctatgccggctggatcgcactggagtcgggtatcagcggcggtgcg
gacgtgatcctgatccccgagatcccctttgaactgaaggccgtctgcaatgccattgaa
ggccggcgccggcgaggcagcaaattcagcattgtggtggcggccgagggagcctttccc
cggggcggtacgcgggtcgtccaaaaaaaggccgatgaaaccatggcaatcgagcggctc
ggcggcatcggcaactttgtggcccacgaacttacctcctgtctcgatatggacatccgg
gtgacagtgctcggccatctccaacggggagggtccccctcaacctttgatcgctgtctc
gggagccgatttggcatcggtgccgttgagcttatcgaaagggagcagtacggagagatg
atctgtctcaagggaagagccatccgttccgttcccattgaaaaagctgtccgcaagctc
aaacttgtcgatccccgaggacagatggtaaccgctgccaaagagctgggaatcaatgtc
ggaagggagtga

DBGET integrated database retrieval system