KEGG   Geobacter metallireducens: Gmet_1653Help
Entry
Gmet_1653         CDS       T00295                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gme  Geobacter metallireducens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gmet_1653 (gpmA)
   01230 Biosynthesis of amino acids
    Gmet_1653 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gmet_1653 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Gmet_1653 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gmet_1653 (gpmA)
Enzymes [BR:gme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Gmet_1653 (gpmA)
Exosome [BR:gme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Gmet_1653 (gpmA)
  Exosomal proteins of melanoma cells
   Gmet_1653 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1858881..1859624
Genome map
AA seq 247 aa AA seqDB search
MKKLVLLRHGESVWNRENRFTGWTDVGLSEKGIEEAISAGRTLKEEGFVFDVAYTSVLKR
AIKTLWLVLEEMDLMWIPEYRHWRLNERHYGALQGLNKAETAERHGMEQVMIWRRSYDIP
PPPLTPDDQRFPGSDPRYASLLPEELPLTESLKDTVARFLPYWHETIAPAVKEGKRVLVT
AHGNSLRALVKYLDLVSDSEIVNLNIPTGIPLVYELTDNMTPIRSYYLGDPDDVARASRM
VADQIKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctcgttttgcttcgtcacggcgaaagcgtctggaacagggagaaccgtttc
accggctggaccgatgtggggctcagcgagaaggggatcgaggaggcaatcagtgccggg
cgcaccctgaaagaagaagggtttgttttcgacgtggcctacacgtcggtcctcaagcgg
gccatcaagaccctctggctcgtcctggaagagatggatctcatgtggatcccggaatac
cgccactggaggctcaacgagcgtcactacggagcgctccaggggctcaacaaggcggag
accgccgaacggcacggcatggagcaggtcatgatctggcgccgcagttacgatatcccg
ccgcctcccctgacccccgacgatcagcggtttccgggaagcgatcctcgctatgcatca
cttttacccgaggagttaccactcaccgaatccctcaaggacacggtcgcccgttttctt
ccctactggcatgaaaccatcgcccccgccgtaaaagaagggaaacgggttctcgtcacc
gcccacggcaacagcctgcgggcccttgtaaaatacctggatctggtctctgactccgaa
atcgtcaacctcaatattcccaccggcattccccttgtctacgaactaacggataacatg
acacccatcaggagctactatctcggtgatccggatgacgtggccagggcaagcaggatg
gtggcggatcagataaagaagtaa

DBGET integrated database retrieval system