KEGG   Geobacter metallireducens: Gmet_1676Help
Entry
Gmet_1676         CDS       T00295                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gme  Geobacter metallireducens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Gmet_1676 (glpK)
Enzymes [BR:gme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Gmet_1676 (glpK)
Exosome [BR:gme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gmet_1676 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1882926..1884416
Genome map
AA seq 496 aa AA seqDB search
MSYILALDQGTTSSRAIVFDTTATIRAIAQREFRQIFPRPGWVEHDGREIWATQVGVAAE
ALTRAGISPREVRAIGITNQRETTLLWDRRSGEPLHNAIVWQDRRTAELCDRLKADGLEP
LFRQKTGLVLDAYFSGTKLAWLLEAIPGARSRAEAGELAFGTVDSWLAWNLSGGKLHVTD
ASNASRTLLFNITTLDWDDELLAILGIPRAVLPRVVDSGAVYGETAGDIFAAAIPLAGMA
GDQQAALFGQACGTAGMAKNTYGTGCFLLMHCGTRPIESRHNLLTTVAWQLGGRAEYALE
GSVFVAGAAVQWLRDGLGIIRSSGEVEALAASVPDSGGVCLVPAFTGLGAPHWDPYARGT
IVGITRGTTAAHIARATLESIAFQSADLLTAMEADAGISLAELRVDGGATANGLLMQFQA
DLLGVPVVRPRISETTALGAAYLAGLAVGLWRDRQEIAGHWQVDRIFEPAMGREQAAELR
GRWGRAVERARGWAAP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagttatatccttgccctggatcagggcactaccagttcccgcgccattgtcttcgac
accaccgcaacgatccgcgccattgcccagcgggagttccgccagatatttccccggccc
ggctgggtggaacacgacggccgggagatctgggccacccaggtgggcgtggcggccgaa
gccctgacccgggccggcatctctccccgggaggtacgggccatcggcatcaccaaccag
cgcgagacaacgctcctctgggaccgacgaagcggcgagccgctccacaacgccatcgtc
tggcaggaccgccgcaccgcggaactctgcgaccggctcaaggccgacggcctggaaccc
ctgttccggcagaagaccggcctggtactggatgcctacttttccggcaccaagctggcc
tggctgctggaggccatacctggcgcccgcagccgcgccgaagcgggggagctggccttc
ggcacggtggattcctggctggcctggaacctgtcgggaggaaagctccatgtcaccgac
gccagcaacgcctcccggacgctcctcttcaacatcactaccctggattgggacgacgag
ctgttggcgatcctcgggataccccgggcagtgctgccgcgggtggtggattccggcgcc
gtttacggcgagaccgccggggatatttttgctgcggcgattccccttgccggcatggcc
ggggaccagcaggcggccctcttcgggcaggcctgcggcacggcagggatggccaagaac
acctacggcaccggctgcttcctgctgatgcactgtggaacacggccgatagagtcccgg
cacaacctgctcaccaccgttgcctggcaactgggcggacgggctgaatacgcccttgag
gggagcgtgtttgtggccggcgctgcggtgcagtggctccgggacggcctgggcatcatc
cgctcctccggcgaggtggaggcccttgcggccagcgttccggacagcggcggtgtctgc
ctggttcccgccttcaccggactcggcgccccccactgggatccctacgcccggggcacc
atcgtcggcataacccgcggcaccaccgcggcacacatcgcccgggccaccctggagagc
atcgccttccagagcgccgacctcctcaccgccatggaggccgacgccggcatcagcctg
gccgaattgcgggtcgacggaggcgcaacggccaacgggctcctgatgcagttccaggcc
gacctcctcggggtgccggtggtgcggccccggatcagcgagaccacggccctgggggct
gcctacctggcgggactggcggtggggctctggcgtgaccgtcaggagattgccggccac
tggcaggtggaccggatcttcgagccggccatgggccgcgagcaggcggcagagctacgg
ggaaggtgggggcgggccgtggagcgggcccgggggtgggcggcgccatga

DBGET integrated database retrieval system