KEGG   Geobacter metallireducens: Gmet_1892Help
Entry
Gmet_1892         CDS       T00295                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gme  Geobacter metallireducens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gme03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2107631..2109415)
Genome map
AA seq 594 aa AA seqDB search
MMAPETSDYRDIDFRFADFICRLAGNGSDELRRAALRVSNAVGQGHICVDLAAEAEGEEE
SGCYTELLRSSGVVGSPGEFATLILDDTRLYLYRYWKYERELAEKIRDNAGRTYPVDCRL
LGEGVVRLFGPPTDGGETDWQRIAAAAALRSGFTVISGGPGTGKTSTVVKIIALLLEQSG
DDGLGIALTAPTGKAAARLKDAIRGAREGLAGLTPVQDRIPDDVTTIHRLLGVIPGANRF
RYNRGNPLPHDVVVVDEASMVALPLMARLVEAMAPKARLILLGDRDQLASVEAGAVLGDI
CDTGDTPMYSTEFRRYVEEATGERLEMGSGDEPLSPLADSLVILRKNYRFGADSGIGALS
RAINDGDGDSALALLREEGTSGVAWRETPSVEALEQALAPEVISGYGDYLSHDDPATVLA
DFDRFRVLCVVREGRYGVAGLNSAIERILAGRGIISPNRRWYRGRPVMVTVNDYALRLFN
GDVGITLPDPENPDTLAVFFPSATEGVRKVSPLRLPPHETVFAMTVHKSQGSEFDRILMV
IPPVENPVLTRELLYTGITRARAAAGLWCGEAVFNAAVARRVERRSGLRNALTK
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcctgaaaccagcgactaccgcgacatagatttccgtttcgccgattttatc
tgccgccttgccgggaacgggagcgatgagttgcggcgggcggccctccgggtgagcaat
gcagttggccagggacacatctgtgtcgacctcgccgctgaagcggaaggggaagaggag
agcggctgctataccgaactcctgcgctcatccggtgttgtgggaagtcccggtgaattt
gccacgctgatccttgacgatacccggctctacctctaccgatactggaagtatgagagg
gaacttgctgaaaaaataagagataacgctgggcggacctatccggtggattgccgtttg
ctgggagagggggtggtacggctcttcggccctcccaccgatgggggggagaccgactgg
cagcggatagcggcggcagccgcactgcgcagcggcttcacggtcatttccggcgggccg
ggaaccggaaagacctccaccgtcgtcaagatcatcgccctgctcctggagcaatccggc
gacgacgggctgggcatcgccctcacggcgcccacgggaaaggctgccgcgcggctcaag
gatgcgatccgcggggccagggaagggcttgccggcttgaccccggtgcaggaccggatt
cctgatgatgtgacgaccatccaccggctcctgggggtgattccgggggcaaaccgtttc
cggtacaaccgggggaacccgctaccccacgacgtggtggtggtcgatgaggcctcaatg
gtggcactccccctcatggcccgccttgtggaggcaatggcgcccaaggcccgcctcatc
ctcctgggggaccgggatcagctcgcctcggtggaagccggcgccgtcctgggcgacatc
tgcgacactggcgatacacctatgtattcgacggagttccgtcgctatgttgaagaggcc
acgggggagcgtctggaaatgggctcaggtgatgaaccactttcaccccttgccgattcc
ctagttatcctccgcaaaaactatcgttttggtgccgacagcggcatcggcgccctcagt
cgcgccatcaacgacggggacggggacagtgctctggcgctccttcgcgaagagggcacc
tccggcgttgcctggcgcgaaaccccgtccgtcgaagcactggagcaggcccttgccccc
gaggtcatttcgggatacggcgattacctctcccatgacgatcccgcaacggtcctggcc
gacttcgaccggttccgggtgctttgcgtcgtgcgggaaggtcggtatggcgttgccggc
ctcaatagtgcaatcgagcggatacttgccggcagggggatcatctctccgaaccggcgc
tggtaccgggggcggccggtcatggtgaccgtcaacgattacgctttgcgactcttcaac
ggcgacgtcgggatcacacttcccgacccggagaatcccgataccctcgctgttttcttt
ccatccgcaaccgaaggtgtccggaaggtgtcgcctctgcgcttgccgccccacgaaacg
gtctttgccatgacggtccacaagagccaggggagcgagttcgacaggatactcatggtg
atcccccccgtcgaaaacccggtgctgacccgggaactgctttacaccggcatcacccgc
gcccgcgcggcggctggactctggtgcggagaagcggtgttcaatgccgccgtggcccgc
cgggtcgagcgcaggtcgggtttgcggaatgctctgaccaagtaa

DBGET integrated database retrieval system