KEGG   Geobacter metallireducens: Gmet_1948Help
Entry
Gmet_1948         CDS       T00295                                 

Gene name
tpi
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gme  Geobacter metallireducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gmet_1948 (tpi)
   01230 Biosynthesis of amino acids
    Gmet_1948 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gmet_1948 (tpi)
   00051 Fructose and mannose metabolism
    Gmet_1948 (tpi)
   00562 Inositol phosphate metabolism
    Gmet_1948 (tpi)
Enzymes [BR:gme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gmet_1948 (tpi)
Exosome [BR:gme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gmet_1948 (tpi)
  Exosomal proteins of bladder cancer cells
   Gmet_1948 (tpi)
  Exosomal proteins of melanoma cells
   Gmet_1948 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2176614..2177369
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLFKKSSEAQDFVAELIPLVQKTTDVEIVIAPVFTVLSAVKRAIADCNIM
LSAQDCFWEEEGAFTGEISPGMLVDAGCSHVIIGHSERRQYFGETDETVNRKIKAAITAG
LTVLFCIGETLAEREADKTFEVLRTQIENGLAGLARGDLAKIVIAYEPVWAIGTGKTATD
EQAQIAHAFIRKVVGELFTVQIAETIRILYGGSVKPENVRGLMNQPDIDGALVGGASLKA
DSFGAIVNYKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccgattattgctggcaattggaaactcttcaaaaagagcagcgaagcacaa
gacttcgttgccgaactgatccctctcgtccagaaaaccactgacgtggaaatcgttatt
gcgcctgtatttaccgttctttctgccgttaaacgagccattgccgattgcaacataatg
ctttctgctcaagattgcttctgggaagaggaaggggccttcaccggcgaaatttctccc
ggcatgcttgtggacgccggatgcagccatgttataattggccattccgagcggaggcag
tattttggtgaaaccgacgaaaccgtcaaccggaagatcaaggcggctattacagcaggt
cttacagtccttttctgcatcggtgaaacacttgccgaacgtgaagcagacaaaaccttt
gaggtgctcaggacccagatcgagaatggtttggccggactcgcaaggggcgatcttgcc
aaaatcgtaattgcgtacgaaccggtctgggccataggtaccggtaaaaccgccactgat
gagcaggcacagatagcgcatgcattcatccgcaaggtcgtgggcgagctgtttaccgtc
cagatagccgaaactattcgtatactctatggcggaagcgtaaaaccggaaaatgtcaga
gggctcatgaatcaacctgacatcgacggcgctttggtgggtggagcgagcctcaaggca
gactcatttggagcaatcgtcaactataaagcgtaa

DBGET integrated database retrieval system