KEGG   Geobacter metallireducens: Gmet_1948Help
Entry
Gmet_1948         CDS       T00295                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gme  Geobacter metallireducens
Pathway
gme00010  Glycolysis / Gluconeogenesis
gme00051  Fructose and mannose metabolism
gme00562  Inositol phosphate metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme01130  Biosynthesis of antibiotics
gme01200  Carbon metabolism
gme01230  Biosynthesis of amino acids
Module
gme_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gme_M00002  Glycolysis, core module involving three-carbon compounds
gme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gmet_1948 (tpi)
   00051 Fructose and mannose metabolism
    Gmet_1948 (tpi)
   00562 Inositol phosphate metabolism
    Gmet_1948 (tpi)
Enzymes [BR:gme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gmet_1948 (tpi)
Exosome [BR:gme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gmet_1948 (tpi)
  Exosomal proteins of bladder cancer cells
   Gmet_1948 (tpi)
  Exosomal proteins of melanoma cells
   Gmet_1948 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABB32177
JGI: Gmet1948
UniProt: Q39U97
Position
2176614..2177369
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKLFKKSSEAQDFVAELIPLVQKTTDVEIVIAPVFTVLSAVKRAIADCNIM
LSAQDCFWEEEGAFTGEISPGMLVDAGCSHVIIGHSERRQYFGETDETVNRKIKAAITAG
LTVLFCIGETLAEREADKTFEVLRTQIENGLAGLARGDLAKIVIAYEPVWAIGTGKTATD
EQAQIAHAFIRKVVGELFTVQIAETIRILYGGSVKPENVRGLMNQPDIDGALVGGASLKA
DSFGAIVNYKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccgattattgctggcaattggaaactcttcaaaaagagcagcgaagcacaa
gacttcgttgccgaactgatccctctcgtccagaaaaccactgacgtggaaatcgttatt
gcgcctgtatttaccgttctttctgccgttaaacgagccattgccgattgcaacataatg
ctttctgctcaagattgcttctgggaagaggaaggggccttcaccggcgaaatttctccc
ggcatgcttgtggacgccggatgcagccatgttataattggccattccgagcggaggcag
tattttggtgaaaccgacgaaaccgtcaaccggaagatcaaggcggctattacagcaggt
cttacagtccttttctgcatcggtgaaacacttgccgaacgtgaagcagacaaaaccttt
gaggtgctcaggacccagatcgagaatggtttggccggactcgcaaggggcgatcttgcc
aaaatcgtaattgcgtacgaaccggtctgggccataggtaccggtaaaaccgccactgat
gagcaggcacagatagcgcatgcattcatccgcaaggtcgtgggcgagctgtttaccgtc
cagatagccgaaactattcgtatactctatggcggaagcgtaaaaccggaaaatgtcaga
gggctcatgaatcaacctgacatcgacggcgctttggtgggtggagcgagcctcaaggca
gactcatttggagcaatcgtcaactataaagcgtaa

DBGET integrated database retrieval system