KEGG   Geobacter metallireducens: Gmet_2069Help
Entry
Gmet_2069         CDS       T00295                                 

Gene name
sucC-2
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gme  Geobacter metallireducens
Pathway
gme00020  Citrate cycle (TCA cycle)
gme00640  Propanoate metabolism
gme00660  C5-Branched dibasic acid metabolism
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01120  Microbial metabolism in diverse environments
gme01130  Biosynthesis of antibiotics
gme01200  Carbon metabolism
Module
gme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gmet_2069 (sucC-2)
   00640 Propanoate metabolism
    Gmet_2069 (sucC-2)
   00660 C5-Branched dibasic acid metabolism
    Gmet_2069 (sucC-2)
Enzymes [BR:gme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Gmet_2069 (sucC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABB32298
JGI: Gmet2069
UniProt: Q39TX6
Position
complement(2326778..2327941)
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKAILRRFGVPVPDGHVCYNGASAREWAKRLGDGPWVVKAQIHAGGRGKGGGV
KLARTSQEVQLIARNMLGMTLRTHQTGPDGKLVTRVLVENGCNIDRELYISLLVDRSTSK
VTVMASTEGGMDIEEVAATTPEKIFKEAIDPLVGLSPFQCRNLAFSLGLTGKLLPKAQKL
LENLYATFIACDCSLLEINPLVVTKEGDLLALDAKFGFDDNAIFRHLQISDMRDYDEEDP
NEVEASQHDLSYVSLNGNIGCLVNGAGLAMATMDIIKFSGGEPANFLDVGGGATIERVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIATGVIEAARQVSLQVPLVVRLEGTNVALGKQL
LSESGLNIVAADGMADGAQKIVQAVAA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggcaaaagcaatccttcgcagattcggcgtacccgtccct
gacgggcacgtctgctataacggcgccagcgcccgtgaatgggccaagcgtctcggtgac
ggaccatgggtggtcaaggcccagatccacgccggcggccgcggtaagggtgggggggtc
aagctggcccgcaccagccaagaagtgcagctcatcgcccgtaacatgctcggcatgacc
ctgcgcacccatcagaccggccccgacggcaagttggtcacccgggtcctggtggaaaac
ggctgcaacatcgaccgggagctgtacataagcctcctggtggaccggagcacctccaag
gtgaccgtcatggcctccaccgaggggggcatggacatcgaggaagtggcggcaacgacc
ccggagaagatcttcaaggaagccatcgatccgctggtagggcttagccccttccagtgc
cgtaaccttgccttcagcctggggctcaccggaaagcttctgcccaaggcgcagaagctt
ctggaaaatctctacgctaccttcatcgcttgcgactgttcgcttctggaaataaacccc
ctggtcgtcaccaaggaaggggaccttctggccctggacgccaaattcggctttgacgac
aacgccattttccggcacctgcagatctccgacatgcgcgactacgacgaggaggatccc
aacgaagtggaggcctcccagcacgacctctcctacgtctccctgaacggcaacatcggc
tgcctcgtgaacggcgcgggcctcgccatggccaccatggacatcatcaagttctccggc
ggcgagccggccaacttcctggacgtggggggcggggccaccatcgagcgggtcaccgag
gccttcaagatcatcctctccgacaagaacgtgaaggggatcttcgtcaacatcttcggc
ggcatcatgaagtgcgacgtcatcgccacgggcgtcatcgaggctgcccggcaggtatcc
cttcaggtgccgctcgtggtgcggctcgaagggaccaacgtggccctcggcaagcagctt
ctgtccgagagtgggctcaacatcgtggccgccgacggcatggccgacggagcacaaaaa
atcgtccaggccgttgccgcctga

DBGET integrated database retrieval system