KEGG   Geobacter metallireducens: Gmet_2172Help
Entry
Gmet_2172         CDS       T00295                                 

Gene name
asnB-1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gme  Geobacter metallireducens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gmet_2172 (asnB-1)
Enzymes [BR:gme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Gmet_2172 (asnB-1)
Peptidases [BR:gme01002]
 Cysteine Peptidases
  Family C44
   Gmet_2172 (asnB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2452716..2454713)
Genome map
AA seq 665 aa AA seqDB search
MCGITGFMDFSLQCGPDAMRANARRMADALMHRGPDDSGAWCDQGAGVGLAHRRLSILDL
TPAGHQPMESRSGRFTIVFNGEIYNHQALRKELAAFEPWRGHSDTETLLAGFEAWGIEAT
LKRTVGMFALAVWDNAERTLTLARDRMGEKPLYYGWNQGVFLFASELKALRAYPGFDAEI
NRDAIALLMRHSCIPTPHSIYRGIYKLWPGTILTLRNTGRGIAPWDAADPPFKLFQGEGV
SLRPYWSLLEAAEQGHARPFEGTESEAIGELERVLTEAVLAQQISDVPLGAFLSGGVDST
AIVALMQAHSSRPVKTFTIGFHEDDCNEAKYAGEIASRLGTDHTELYVSPGDSLAVIPRL
PQLYDEPFSDPSHIPTFLVSLLAREHVTVSLSGDGGDELFGGYVRHTLLHRIWNNIGWCP
LPMRKALSDKIRFLSPGQLQAVLRNLPFIDRVHAPVYKAYRLAELIRADSPASMYEICIS
HWQQDDPVVVGGQSPFHASSGRMPRQLDSFSLPEKIMLMDSVTYLPDDILVKIDRAAMGV
SLETRVPFLDHRVVEFAWRLPLGLKIRGGQSKWILRQVLNRHIPKELVERPKHGFGIPLG
TWLRGPLREWAEELLNESRLLREGFLDPRPVRQKWLEHVSGRRDWEFHLWDVLMFQSWLE
QERRP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcataaccggtttcatggatttctcactgcaatgcggacctgacgccatgcga
gccaacgcacggcgcatggcggatgccctcatgcaccgcggccccgatgacagtggcgcg
tggtgcgaccagggggcgggtgtcggcctggcgcaccgccggctctccatcctcgatctt
acccctgccggccaccagcccatggaatcgcgttccgggcggttcacgatcgtcttcaac
ggcgagatttacaatcatcaggcactgcggaaggagttggcggcgttcgagccctggcgg
gggcattcggacacggagaccctcctggccggattcgaggcatggggcatcgaggccacg
ctcaagaggacggtcggcatgttcgccctggcagtgtgggacaatgcggagaggacgctg
acccttgcccgcgaccgcatgggtgagaagcccctgtactacggctggaaccagggcgtt
ttcctctttgcctcggagctgaaggcgctgcgggcctatccgggtttcgacgcggaaatc
aaccgcgacgccattgccctcctcatgcgccacagttgcattcccacgccccactcgatc
tatcgcggcatctacaaactctggccgggaaccatactgactctgcgaaacacgggccgc
ggaatcgccccctgggatgccgccgatccccccttcaagctgtttcagggagagggggtt
tcccttcgcccgtactggtcattgctggaggcggcggagcaggggcatgcccgccccttt
gaggggacggaaagcgaggcgataggggaacttgaacgggttctgacggaagccgtgctg
gcgcagcagatctccgatgtgccgttgggggctttcctgtcagggggggtggattcgacc
gccatcgtggccctgatgcaggcccactcgtcccggccggtgaagacctttaccatcggt
ttccacgaggatgactgcaacgaggcgaaatatgcaggggaaatcgcctcccgcctgggg
accgaccataccgagctgtacgtgtcgcccggtgattcgctggcagtgattcctcgcctg
ccgcagctttatgacgagccgttttcggacccttcgcacatccccacgtttctggtgtcc
ctgctggcacgggagcacgttacggtttccctgtccggagacggcggggacgagctgttc
gggggttatgtccggcacaccttgctccacaggatctggaataacatcggctggtgcccg
ttgccgatgcgaaaagccctgtccgacaagatcaggtttctttcgccgggccagctccag
gccgttctgcggaatcttcccttcatcgacagggtccacgcccccgtctacaaggcctac
cggcttgccgagctgatccgggcggattcccccgcatccatgtacgagatatgcatctcc
cactggcagcaggacgacccggttgtcgtggggggccaatcccccttccatgcatcatcc
ggccggatgccccgccagctcgattcgttcagcctgccggaaaagatcatgctcatggac
agcgtcacctatctgcccgacgatattctcgtgaaaatcgaccgggcagccatgggggta
agcctggaaacgcgggtgccgttcctcgatcatcgggtggtggagtttgcctggcggctg
ccgctcggcctgaagatccgcgggggccaaagcaagtggattttgcgccaggtgctgaac
aggcatatcccgaaagagcttgtggagcgcccgaagcatggcttcggcatcccgctgggg
acgtggttgcgggggccgctgcgcgaatgggccgaggagcttctcaatgagtcccggctg
ctgcgcgaagggtttctggaccccaggccggtgcggcaaaaatggctggagcacgtttcc
gggcgccgggattgggaattccacctgtgggacgtgctgatgttccagtcgtggctcgag
caggaaagaagaccatga

DBGET integrated database retrieval system