KEGG   Geobacter metallireducens: Gmet_2250Help
Entry
Gmet_2250         CDS       T00295                                 

Definition
protein disulfide bond isomerase, DsbC/DsbG-like, one heme-binding site
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gme  Geobacter metallireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2546458..2547312)
Genome map
AA seq 284 aa AA seqDB search
MHQMIRFFWGGNMKWLMRILLPFAFVSTAYGFGTGTEGCSGNCIACHTIKKEEVVALVKN
VDPATTVESVGPSPVRGLFEIIIRHNDSTGIIYLDFSKKFLIAGRILDTGSKKDVTATAL
NRVRRIDPSKLPLDNALVLGNATGSRNIYVFTDPECPFCAKFHRELVALTKEDPQLGVRI
ILTPLDIHPRASAVTNSILCAAQDGMDKGLRLLEESFNGTAIADITCGRDYAEEGKTLFK
ELRIRMTPTTVLSDGRVVDGVKTGAEIEKLFDDTEHGVITEKPQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccaaatgatccggttcttctgggggggcaatatgaaatggttgatgagaattctc
ctgccgtttgcgtttgtatcgacggcatatggtttcggaacgggaacggaaggatgtagt
ggaaactgcatagcctgccacactatcaagaaggaagaggtcgtagccttggttaagaat
gttgaccctgctactacggtagaatcggtcgggccttctcccgtgcggggattatttgaa
ataataataagacataatgatagcactggcatcatatatcttgatttttcgaagaaattc
ctcattgcaggcagaatacttgatactggcagcaagaaagacgtaaccgcaaccgccctt
aatcgggtgcggcgtattgacccatcaaaactcccgcttgacaatgctctcgtcctcggt
aacgcaactggcagcagaaatatttatgtcttcaccgacccggaatgtccgttttgcgcc
aagttccatcgggagcttgttgcactgaccaaagaggacccgcagttaggggtccgtatc
atacttactcctcttgatattcatccccgagcttctgctgtaaccaactccattttgtgc
gcggcacaggacggaatggataaagggctgcgacttctggaagaaagtttcaatggtact
gcgattgcagatataacctgcggcagggactatgccgaagaagggaaaactctgttcaaa
gaactgagaattcgcatgacgcccactaccgttttatccgatgggcgggtcgtagatggt
gtaaagacgggcgctgaaattgagaaacttttcgatgatactgagcatggagtcattaca
gaaaaaccacaataa

DBGET integrated database retrieval system