KEGG   Geobacter metallireducens: Gmet_2289Help
Entry
Gmet_2289         CDS       T00295                                 

Definition
aldehyde:ferredoxin oxidoreductase, tungsten-containing
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gme  Geobacter metallireducens
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gmet_2289
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gmet_2289
Enzymes [BR:gme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Gmet_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2594599..2596353)
Genome map
AA seq 584 aa AA seqDB search
MVGVAVQGWTGRMLCVDLATRESRRETIPAEFLQAYLGGRGLGVRLMRDWYRLDPYDPAM
PLIFAVGPLCGTPAPTAARLSVVSRSPLTGTIYDCSAGGRFAWRLKAAGFDALVVTGKSA
TPVAIAITPSGAEIVDASQLWGKTVHDTVTALAGRGSVATIGPAGERGVLFANIMMGEGN
SVGRGGLGAVMGAKGLKAVVVNGDQPVVIADRERFEKARQDVMRLFRASPVIFGELGIGE
YGTPALVDLMRQRRMAPTDNFRRTVFEESGNYSGPAIRRDFHAKKDGCYGCPIQCKKSTP
AGEHLPEYETLSHFGGLNGIASLASIVKSNTLCNELGMDTISAAATLSAWGEARGSFPDG
EEVQRLLADIAFRRGDGELLSLGSRRVAEALGQPGLSMSVKGLELPAYDPRGAYGMALAY
CTSNRGGCHLRAYPISHEILRKPIATDRFSFSGKARIIAIAEDTNAAVDSLVACKFSFFG
ATLEEYAELLSATTGIDYSPQDLKEIGRRICLTERFYNCDNGFSVADDSLPERFFSEPGS
SGEGVEIPPLDRARFDEELQKYYRIRGLTPEGVFADRDLLVKQP
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggttggggttgcggtgcagggatggaccgggcgcatgctgtgtgtcgatctggcgaca
agggagagtcggcgcgagacgattccggcggaatttctccaggcctatctggggggccgg
gggcttggggtgaggctcatgcgggattggtaccggctcgatccctacgatccggccatg
ccgctcattttcgccgtcggtcccctctgcggcacgccagcccctacagcggcccgcctt
tcggtcgtgtcccgctctcctcttaccggcaccatctacgactgctccgccggagggcgc
tttgcgtggcgcctgaaagcggcagggttcgatgctttggtggttaccggcaaaagtgca
acccctgttgccattgcgattacgccgtcgggcgccgagatcgtcgatgcgagccagctt
tgggggaaaacggtccatgataccgtcacggcccttgccggccgcggaagcgtggcaacc
atcgggccggctggagaacgaggggtcctcttcgccaatatcatgatgggagaagggaat
tcggtggggcgtggcggcctcggtgcggtcatgggggcgaaggggctgaaggcggttgtg
gtgaatggcgaccagcccgtggtcatcgccgaccgggagcggttcgaaaaggctcggcag
gacgtgatgcggcttttccgcgcttcacctgtcatcttcggcgaactggggattggcgaa
tatggcacgccggccttggtggatctcatgcgccagcgccgcatggcccctaccgacaac
ttccggcggaccgtcttcgaggagtcggggaactactccgggcccgccattcgacgcgat
ttccacgccaaaaaagacggctgctacggctgccccatccagtgcaagaagagtactcct
gccggagagcatcttcccgaatacgagaccctctcccatttcggggggttgaacggcatt
gccagccttgcatcaatcgtgaaatccaacaccctctgcaacgaactggggatggacacc
atctccgccgccgccaccctctcggcctggggggaggcgcgtggcagtttccctgatggc
gaggaggtgcagcgactgctggccgacatcgccttccgccggggtgacggtgagcttctt
tcgctcggttcccggcgggttgccgaggccctggggcagcccggcctctccatgagtgtc
aaggggttggagcttcccgcctacgatccccgtggcgcctacggtatggccctggcctat
tgcaccagcaaccgtggcggatgccacctgcgcgcctatcccatttcccacgagatcctc
cgcaagcccattgccaccgaccgcttttcgttctcgggcaaggcgcggatcattgccatt
gccgaggacaccaacgccgccgtcgattccctggttgcctgcaagttctcgttcttcggt
gccacgctggaagaatatgccgagctgttgtcagcaaccaccggtattgactactcaccc
caggacctcaaggagatcggtcggcggatttgcctcaccgagcggttctacaactgcgac
aacggattcagtgtggcggacgacagtctcccggagcggttcttttcggagccgggctcc
agtggggagggggtcgaaattcctcccctcgatcgagcgcgctttgatgaggagttgcag
aagtactaccggattcgcggcctcaccccggagggggtgttcgcggatcgggacttgctg
gtgaagcagccataa

DBGET integrated database retrieval system