KEGG   Geobacter metallireducens: Gmet_2294Help
Entry
Gmet_2294         CDS       T00295                                 

Definition
(GenBank) aminopeptidase, M42 family
Organism
gme  Geobacter metallireducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20
Motif
Other DBs
NCBI-ProteinID: ABB32519
JGI: Gmet2294
UniProt: Q39TA5
Position
complement(2600934..2602004)
Genome map
AA seq 356 aa AA seqDB search
MRQESLDFFKQLVEAPSPSGYEQPAQRVFRDYIAPFAEVTTDVMGNVFGLIRGEGEDLPR
VMIVGHSDEIGFQVKYIDDNGFIFFAPIGGVDAHLTPGKRVRIHTAKGEVAGVIGKKPIH
LMDEEDRKKVVRLDAQYIDIGAADKNDAQEAVRVGDPVTFAVGFESLLGDRVASRAFDDK
AGSFVVAEVLRTVAESGVKLPVDLYGVSSVQEEIGLRGGTTSSYSVNPHVGICVEVDFAT
DQPDVEKKHNGEVKLGKGPILPRGANINHPLFDLLSATADREGIAVQYTGIARATGTDAN
VMQISRGGVATALVKLPLRYMHTPVEVISLSDLENAVRLIVAALPGMGKKEAFILR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggagtccctcgattttttcaaacagctggtcgaagccccaagcccctccggc
tacgaacagccggcccagcgggtctttcgcgattacatcgccccctttgccgaagtgacc
accgatgtcatggggaacgtgttcggcctcatccgcggcgagggtgaagaccttccgcgg
gtcatgatcgtggggcactcggacgagatcggcttccaggtgaagtacatcgacgacaac
ggtttcatcttcttcgctcccatcggcggggtggatgcccatctgacgccggggaagcga
gtccgcatccacacggccaagggagaggtggcgggcgtcatcggcaagaagccgatccac
ctcatggatgaagaggaccggaaaaaggtggtccgccttgacgcccagtacatcgacatc
ggcgcggccgacaagaatgatgcccaggaggccgtacgggtcggcgatccggttaccttc
gccgtcggcttcgagtcgctcctgggggaccgggtcgcttcccgggcctttgatgacaaa
gccgggagcttcgtggtggccgaggtgctccgaaccgtggccgaatcgggggtgaagctt
ccggtggacctctacggtgtctcgtccgtgcaggaggaaatcgggctccgcggcggcacc
accagctcctacagcgttaacccccatgtggggatctgcgtggaggtggattttgccacg
gatcagcccgacgtggagaagaagcacaacggcgaggtgaagctcggcaaagggccgatt
ctcccccggggggccaacatcaaccaccccctctttgacctcctctcggccacggcggat
cgggaggggattgcggtccagtacaccggcattgcccgggccacaggtaccgacgccaac
gtgatgcagatatcccggggtggcgttgccacagccctggtgaagctgccgctccgctac
atgcacacgccggtggaggtcatctccctctccgatctggagaacgccgttcgacttatc
gtcgctgcgctgccgggtatggggaaaaaagaggcgttcattctgcgctga

DBGET integrated database retrieval system