KEGG   Geobacter metallireducens: Gmet_2374Help
Entry
Gmet_2374         CDS       T00295                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gme  Geobacter metallireducens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gme00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2683974..2684573
Genome map
AA seq 199 aa AA seqDB search
MKSTSALLIVDVQNDFCPGGLLPVPEGDRVVPLLNRYMELFREKKLPIIASRDWHPAITS
HFRDFGGIWPVHCVQGSEGARFHRDLALPDDAIVISKGQDPAQDAYSAFQATTESGVSFP
ELLKELGITRLFVGGLATDYCVKESVLDGLRHGLAVTLLEDAVRGVNLTPGDSARAIENM
VVAGAVRMNFSRLQADPPS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcacgtcagcccttctgatcgtcgacgtccagaacgatttctgccccggaggc
ttgctacccgtaccagagggggatcgggtcgtcccgctgctcaaccgctacatggagctt
ttcagagagaaaaagctgccgatcatcgcatcccgggactggcatccggccatcacatcc
cactttcgggacttcggtggcatctggccggtccactgcgtccaggggagcgagggggcc
cggttccaccgcgacctggcccttccggacgacgccattgtgatctccaagggacaagac
ccggctcaggacgcctattccgcgttccaggcgaccacggaaagcggcgtgtccttcccg
gaactccttaaagagctgggtatcaccagacttttcgtggggggcctcgccacggactac
tgtgtcaaggaatcggttctggacgggctgcgccacggtcttgcggtaacactccttgag
gatgcggtacggggggtcaacctgactcccggcgactcggcaagggctatcgaaaacatg
gtcgttgccggcgcggtgcgaatgaatttcagcaggcttcaggccgaccctccctcgtga

DBGET integrated database retrieval system