KEGG   Geobacter metallireducens: Gmet_2374Help
Entry
Gmet_2374         CDS       T00295                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gme  Geobacter metallireducens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Gmet_2374
Enzymes [BR:gme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Gmet_2374
    3.5.1.-  
     Gmet_2374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2683974..2684573
Genome map
AA seq 199 aa AA seqDB search
MKSTSALLIVDVQNDFCPGGLLPVPEGDRVVPLLNRYMELFREKKLPIIASRDWHPAITS
HFRDFGGIWPVHCVQGSEGARFHRDLALPDDAIVISKGQDPAQDAYSAFQATTESGVSFP
ELLKELGITRLFVGGLATDYCVKESVLDGLRHGLAVTLLEDAVRGVNLTPGDSARAIENM
VVAGAVRMNFSRLQADPPS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcacgtcagcccttctgatcgtcgacgtccagaacgatttctgccccggaggc
ttgctacccgtaccagagggggatcgggtcgtcccgctgctcaaccgctacatggagctt
ttcagagagaaaaagctgccgatcatcgcatcccgggactggcatccggccatcacatcc
cactttcgggacttcggtggcatctggccggtccactgcgtccaggggagcgagggggcc
cggttccaccgcgacctggcccttccggacgacgccattgtgatctccaagggacaagac
ccggctcaggacgcctattccgcgttccaggcgaccacggaaagcggcgtgtccttcccg
gaactccttaaagagctgggtatcaccagacttttcgtggggggcctcgccacggactac
tgtgtcaaggaatcggttctggacgggctgcgccacggtcttgcggtaacactccttgag
gatgcggtacggggggtcaacctgactcccggcgactcggcaagggctatcgaaaacatg
gtcgttgccggcgcggtgcgaatgaatttcagcaggcttcaggccgaccctccctcgtga

DBGET integrated database retrieval system