KEGG   Geobacter metallireducens: Gmet_2391Help
Entry
Gmet_2391         CDS       T00295                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gme  Geobacter metallireducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gmet_2391 (malQ)
Enzymes [BR:gme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Gmet_2391 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2701272..2702762)
Genome map
AA seq 496 aa AA seqDB search
MHHRRKSGILLHPTSLPGPGGIGSLGKECRHFIDFLEAAGQSLWQILPLGPAAYGNSPYS
CYSAFAGNPLLIDLAALVDEGDLDESAPVPVFPAEYVDFALAENYRIPLLKAAAAHFYAF
GDRERKEEYWHFCDTTPWLHDYALFMALKEHFGGKSWTSWPKEIARREPAALEKYSVRLG
VAIGEQKYAQWQFYRQWRHIREYANGKGIGIVGDIPIFVAFDSADVWSAPHLFKLDEKGK
PTVVAGVPPDYFSETGQRWGNPLYNWDAMAAEGYRWWIERFRSCFALCDMVRIDHFRGFE
ACWEVPAKEKTAVNGQWVKGPGAPLFDAVIGALGQLPIIAEDLGVITPEVEELRDRYRFP
GMKILQFAFDSGPGNPYLPHNYIPGCVTYTGTHDNDTTVGWFKTLSPHNRKGVLAYTGTS
GKEIHWELVRLGLASVADLAIFPLQDILGLDGSARMNLPGTPRGNWSWRFTAGALAEKHA
ERLHELTTLFGRKRGE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatcggcgaaaaagcggcatcctccttcatcccacatctcttcccggtccgggg
gggattggatctctcggcaaagagtgcagacactttatcgatttccttgaagccgccggc
cagagcctctggcagattctccccctcggtccggccgcttacggcaactcaccctactca
tgctattcggcctttgcggggaatccgcttcttattgatcttgctgcccttgtggacgag
ggagacctggatgaaagcgcgccggtccccgtgttccctgcggaatacgtcgatttcgcc
ctggcggaaaattacagaattcccctgctgaaggcggcggccgcccatttttacgccttt
ggcgaccgtgagcggaaggaggagtactggcatttctgcgacacaaccccttggctccac
gactacgccctcttcatggcgctcaaggagcatttcggggggaagagctggacctcctgg
cccaaggagatcgcccgcagggagccggcggccctggagaagtattcggttcggctcggt
gtggccattggagagcagaagtacgcccagtggcaattttaccgtcaatggcgccatatc
agggagtatgccaacggcaaggggatcggcattgtcggtgacatcccaatctttgtcgcc
tttgactcggctgacgtctggagcgcgccccatcttttcaagctggacgagaagggaaag
cctacggtcgttgccggggtcccccccgactacttcagtgagaccggtcagcggtggggc
aaccccctctacaactgggacgccatggccgccgagggatatcgctggtggatcgagcgg
ttccgcagctgtttcgccctgtgcgacatggtccgaatcgaccacttccggggcttcgag
gcatgctgggaggtgccggccaaggaaaaaaccgccgtcaacggccaatgggtcaagggg
ccgggggctccccttttcgacgccgtcatcggtgccctggggcaactccccatcatcgcc
gaggatttgggagtgatcacgccggaagtggaggaactcagggaccgttatcgtttcccc
ggcatgaaaatcctccagttcgccttcgattccggcccggggaatccttatctcccccac
aactacatccctggctgcgtaacctacaccggtacccacgataatgacaccaccgtcggc
tggttcaaaacactttcccctcacaaccgcaagggtgtccttgcctacacgggtacctcc
ggcaaggagattcactgggaactggtacggcttggccttgcgtcggtagccgatctggcg
attttcccccttcaggatatcctcggcctcgatggatccgcccggatgaaccttccggga
accccccgcggcaactggtcgtggcgcttcactgctggggcattggcggagaagcatgct
gaacggctccacgaattgacgacgctctttgggagaaagcggggagaatag

DBGET integrated database retrieval system