KEGG   Geobacter metallireducens: Gmet_2482Help
Entry
Gmet_2482         CDS       T00295                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gme  Geobacter metallireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gmet_2482 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gmet_2482 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gmet_2482 (trpB1)
Enzymes [BR:gme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gmet_2482 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2824488..2825678)
Genome map
AA seq 396 aa AA seqDB search
MKLPDKQGHFGQFGGRYVPETLMPALLELEKAYNHYKNDREFKEEFDYYLRQYVGRPNPL
YFAEKLTQKLGGAKIYLKREDLNHTGAHKVNNTIGQGLLAKRMGKKRVIAETGAGQHGVA
TATIAALFGMECEVFMGEEDIRRQALNVFRMKLLGAKVTPVTAGTATLKDAMNEAMRNWV
TYIHNTFYVIGTVAGPHPYPVMVRDFQSVIGREAKAQHKKIEGRLPDVLVACVGGGSNAL
GLFYPFLNDREVRMVGVEAAGHGIASGAHAAPLCAGTVGVLHGNKTYLLQDEFGQIANAH
SVSAGLDYPGVGPEHAWLKDSRRAEYVSVTDDEALEAFTLLTREEGIMPALESSHAIAHV
VKLAPTLPREQTIVACLSGRGDKDIHTVADAMGVQF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacccgacaaacagggccacttcggccagttcggcggccgttacgtgccggaa
accctcatgccggcgctcctggagctggagaaggcctacaaccactacaagaacgaccgc
gagttcaaggaggagttcgactactacctccgccagtacgtggggcgccccaatcccctc
tactttgccgagaagctcacgcaaaagctggggggcgcgaagatctacctcaagcgcgag
gacctgaaccacaccggtgcccacaaggtgaacaataccatcggccaggggcttctggcc
aagcggatggggaagaaacgggtcattgccgagaccggtgccggccagcacggggtggcc
acggccaccattgcggccctcttcggcatggagtgcgaggtcttcatgggggaggaggat
atccggcgccaggccctgaacgtcttccggatgaagctcctgggggcgaaggttacgccg
gtgaccgccggcaccgccaccctcaaggacgccatgaacgaggccatgcggaactgggtg
acctacatccacaacaccttctacgtgatcggcaccgtggcgggaccccacccctatccg
gtgatggtccgcgacttccagtcggtcatcggccgggaggccaaggcccagcacaagaag
atcgagggaaggttgccggatgttctcgttgcctgcgtcggcggcggcagcaatgccctg
gggctcttctacccgttcctcaatgaccgggaggtccggatggtgggggtggaggccgcg
ggccacggcatcgcctccggagcccacgcggcgccgctctgcgccgggacggtcggcgtt
ctccacggcaacaagacctacctcctccaggatgagttcggccagatagccaatgcccac
tccgtttccgccggccttgattaccccggcgttggccccgagcacgcctggctcaaggat
tccaggcgggccgagtatgtgtcggtcaccgacgatgaggccctggaggccttcacgctc
ctgacccgggaggaggggatcatgccggccctggagtcgtcccacgccatcgcccacgtg
gtgaagctggcgccgacactgccgagggagcagaccatcgtcgcctgcctctccggccgg
ggggacaaggatattcacacggtggccgacgccatgggggtacagttttag

DBGET integrated database retrieval system