KEGG   Geobacter metallireducens: Gmet_2482Help
Entry
Gmet_2482         CDS       T00295                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gme  Geobacter metallireducens
Pathway
gme00260  Glycine, serine and threonine metabolism
gme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gme01100  Metabolic pathways
gme01110  Biosynthesis of secondary metabolites
gme01130  Biosynthesis of antibiotics
gme01230  Biosynthesis of amino acids
Module
gme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gmet_2482 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gmet_2482 (trpB1)
Enzymes [BR:gme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gmet_2482 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABB32707
JGI: Gmet2482
UniProt: Q39SR7
Position
complement(2824488..2825678)
Genome map
AA seq 396 aa AA seqDB search
MKLPDKQGHFGQFGGRYVPETLMPALLELEKAYNHYKNDREFKEEFDYYLRQYVGRPNPL
YFAEKLTQKLGGAKIYLKREDLNHTGAHKVNNTIGQGLLAKRMGKKRVIAETGAGQHGVA
TATIAALFGMECEVFMGEEDIRRQALNVFRMKLLGAKVTPVTAGTATLKDAMNEAMRNWV
TYIHNTFYVIGTVAGPHPYPVMVRDFQSVIGREAKAQHKKIEGRLPDVLVACVGGGSNAL
GLFYPFLNDREVRMVGVEAAGHGIASGAHAAPLCAGTVGVLHGNKTYLLQDEFGQIANAH
SVSAGLDYPGVGPEHAWLKDSRRAEYVSVTDDEALEAFTLLTREEGIMPALESSHAIAHV
VKLAPTLPREQTIVACLSGRGDKDIHTVADAMGVQF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacccgacaaacagggccacttcggccagttcggcggccgttacgtgccggaa
accctcatgccggcgctcctggagctggagaaggcctacaaccactacaagaacgaccgc
gagttcaaggaggagttcgactactacctccgccagtacgtggggcgccccaatcccctc
tactttgccgagaagctcacgcaaaagctggggggcgcgaagatctacctcaagcgcgag
gacctgaaccacaccggtgcccacaaggtgaacaataccatcggccaggggcttctggcc
aagcggatggggaagaaacgggtcattgccgagaccggtgccggccagcacggggtggcc
acggccaccattgcggccctcttcggcatggagtgcgaggtcttcatgggggaggaggat
atccggcgccaggccctgaacgtcttccggatgaagctcctgggggcgaaggttacgccg
gtgaccgccggcaccgccaccctcaaggacgccatgaacgaggccatgcggaactgggtg
acctacatccacaacaccttctacgtgatcggcaccgtggcgggaccccacccctatccg
gtgatggtccgcgacttccagtcggtcatcggccgggaggccaaggcccagcacaagaag
atcgagggaaggttgccggatgttctcgttgcctgcgtcggcggcggcagcaatgccctg
gggctcttctacccgttcctcaatgaccgggaggtccggatggtgggggtggaggccgcg
ggccacggcatcgcctccggagcccacgcggcgccgctctgcgccgggacggtcggcgtt
ctccacggcaacaagacctacctcctccaggatgagttcggccagatagccaatgcccac
tccgtttccgccggccttgattaccccggcgttggccccgagcacgcctggctcaaggat
tccaggcgggccgagtatgtgtcggtcaccgacgatgaggccctggaggccttcacgctc
ctgacccgggaggaggggatcatgccggccctggagtcgtcccacgccatcgcccacgtg
gtgaagctggcgccgacactgccgagggagcagaccatcgtcgcctgcctctccggccgg
ggggacaaggatattcacacggtggccgacgccatgggggtacagttttag

DBGET integrated database retrieval system