KEGG   Geobacter metallireducens: Gmet_2493Help
Entry
Gmet_2493         CDS       T00295                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, homodimeric beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gme  Geobacter metallireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gmet_2493 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gmet_2493 (trpB2)
Enzymes [BR:gme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gmet_2493 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2835098..2836453)
Genome map
AA seq 451 aa AA seqDB search
MQTKILLDESRIPTHWYNIIPDMPGPLAPVINPRTLQPVTPDDLLPIFPMAIIEQEVSGE
RWIPIPEEVREIYRLWRPSPLYRARRLEQALGTPAKIYYKYEGVSPAGSHKPNSAIPQAF
YNKQAGIRRLATETGAGQWGSSLALACSMFGLECTVYMVKVSCTQKPYRKSMMQLWGANV
IPSPSEFTNAGRAILAHDPDSNGSLGIAISEAVEDAVSRPDTNYALGSVLNHVCLHQTVI
GQEAKEQLALAGDYPDVVIACCGGGSNFAGTAFPFLADRAAGKNVRCLAVEPASCPTLTK
GVYAFDYGDTAKMAPIAMMYTLGHDFMPPGIHAGGLRYHGESALVSQLHHAGLIEAKSYR
QNACFEAAHLFARSEGIVPAPESSHAVRAAIDEAVLAKEEGKEKTILFCLSGHGQLDMGA
YDAYLSGGLEDFEYPEEMIRESLARLPKVDL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaaaaatcctgctcgacgaaagccgcatccccacccactggtataacatcatc
cccgacatgcccggccccctggcgccagtcatcaatccccggaccctccagccggtgaca
cccgacgacctcctccccatcttccccatggccattatcgagcaggaggtctcgggcgag
cggtggatcccgattcccgaggaggtgcgggagatctaccggctctggcggccgtcaccc
ctctaccgggcgcggcggctggagcaggccctcggcaccccggcgaagatctactacaag
tacgaaggggtgtccccggccggctcccacaagcccaattcggccatcccccaggccttc
tacaacaagcaggccggcatccgtcgcctcgccaccgagaccggcgccggccagtggggg
agttccctggccctggcctgctccatgttcggccttgagtgcacggtctacatggtgaaa
gtgtcgtgcacccagaagccctaccgcaagagcatgatgcagctctggggggccaatgtg
atcccgtcgccctctgagttcaccaacgccggccgtgccatcctggcccacgacccggac
agcaacgggagcctcggcatcgccatctccgaggctgtggaggacgctgtctcccgcccc
gacaccaactacgccctggggagcgtcctgaaccacgtctgcctccaccagaccgtcatc
ggccaggaggccaaggagcagctggccctggccggcgactacccagacgtggtcatcgcc
tgctgcggcggcggctccaacttcgccggcacggcgttcccgttcctggccgaccgagcc
gccggcaagaacgtccgctgcctggccgtggagcccgcctcctgcccgaccctcaccaag
ggggtctatgccttcgactacggcgacaccgccaagatggcccccatcgccatgatgtac
accctgggccacgacttcatgccgccggggatccacgctgggggcttgcgctaccatggc
gagtccgccctggtgtcgcagctccatcacgcggggctcatcgaggcgaagtcgtaccgt
cagaacgcctgttttgaggcggcccacctctttgcccgcagcgaggggatcgtcccggcc
cccgaatcgtcccacgcggtgcgggctgccattgacgaagcggtcctcgccaaggaagag
ggaaaggaaaagactatccttttctgcctctcgggccacggccagctggacatgggggcc
tacgacgcctacctctccggcgggctggaggatttcgagtatcccgaggagatgattcgg
gagtccctggcgcggctgccgaaggtggatctgtaa

DBGET integrated database retrieval system