KEGG   Geobacter metallireducens: Gmet_2711Help
Entry
Gmet_2711         CDS       T00295                                 

Gene name
cheB40H-2
Definition
protein glutamate methylesterase CheB associated with MCPs of class 40H, response receiver domain-containing
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gme  Geobacter metallireducens
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gme02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gme02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3061837..3062880
Genome map
AA seq 347 aa AA seqDB search
MVKVLIVDDSASVRLFLQGLLAADPGIEVIGTAADGDEAVEAVARLNPDVVTMDIYMPRM
NGLLATRRIMETHPVPIVVVSGNLDAEEVASTFRAIEAGAVTALPRPQGPGHPNHEREAR
SFVQAVKLMAEVKVIKRWPRRDNPASLPSLPCQAMVPARLKAVAIGASTGGPMVLQTILA
GLRRDFPLPVLIVQHMATGFIKGFVEWLNLTSALPVHIAGNGDRLIPGHAYVAPDCFHML
VTEDGTAIELQNTPPENGLRPSVSALFRSVTQAFGAQTVGVLLTGMGSDGARELKRLREA
GAVTIVQDRESSVIHGMPGEALKLGAATHTLPPDRIVTALTSLAMEK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggttctcattgtggacgactcggcgagcgtgcggctgttccttcaggggctg
ctcgccgccgacccggggatagaggtgatcggcaccgcggcggacggggatgaagctgtc
gaagcggtggcgcggctgaatcccgacgtggtaaccatggacatctacatgccgcggatg
aacggcctgctcgccacccgccggatcatggaaacccacccggtccccatcgtcgtggtg
agcggaaaccttgacgccgaggaagtcgcctcgaccttccgtgccatagaggcgggggcc
gtcaccgccctgccgcgcccccagggccccggccatccgaaccacgagcgggaagccagg
tccttcgtccaggccgtgaagctgatggctgaagtcaaggtgataaagcggtggccccga
cgcgacaacccggcctccctcccttctttgccatgccaggcgatggttccggcgcggctc
aaggcggtagccatcggcgcttcgaccggcgggcccatggttctccagaccattcttgcc
ggtctgcgaagggatttcccgctgccggtcctcatcgtccagcacatggccacgggcttc
atcaagggatttgtcgagtggctcaacctcacctcggccctgccggtgcacattgccggc
aacggcgaccgactcatccccggccacgcctacgtggcgccggactgttttcacatgctc
gtgaccgaagacggaactgcaatcgagttgcagaacacccccccggaaaacggcctccga
ccatcggtctctgccctcttccgctccgtgacgcaggcttttggcgcccagacggtcggt
gtgctcctcaccggcatgggaagcgacggcgccagggaactgaagcgcttacgcgaggcc
ggagccgtcaccatcgtgcaggaccgggaaagctccgtcattcacggaatgccgggcgag
gccctgaaactgggggcagcgacccacacgctccctcccgaccggatcgtgaccgccctt
accagcctggctatggagaagtga

DBGET integrated database retrieval system